SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001119 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001119
Domain Number 1 Region: 12-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.14e-77
Family BAR domain 0.00000000189
Further Details:      
 
Domain Number 2 Region: 305-364
Classification Level Classification E-value
Superfamily SH3-domain 4.07e-23
Family SH3-domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001119   Gene: ENSMLUG00000001222   Transcript: ENSMLUT00000001221
Sequence length 369
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429911:1421332:1456797:-1 gene:ENSMLUG00000001222 transcript:ENSMLUT00000001221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSKKTYKRDFFKFPQKVSEKVGGAEGTKLDHDFKEMERKVDVTSRAVMEIMTKTIEYLQP
NPASRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEA
MRELSEVKDSLDMEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPD
EEIRQALEKFDESKEVAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRL
EERIREASSQPRREYQPKPRMSLEFPIGDNTQPNGGISHAGTPKPSEIISFSRSDSTVKL
LHKSVPMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFPINY
VEILVALPH
Download sequence
Identical sequences G1NV41
ENSMLUP00000001119 ENSMLUP00000001119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]