SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001136 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001136
Domain Number 1 Region: 119-261
Classification Level Classification E-value
Superfamily PH domain-like 3.94e-26
Family Phosphotyrosine-binding domain (PTB) 0.0082
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000001136
Domain Number - Region: 520-559
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0034
Family Ypt/Rab-GAP domain of gyp1p 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001136   Gene: ENSMLUG00000001234   Transcript: ENSMLUT00000001239
Sequence length 570
Comment pep:novel scaffold:Myoluc2.0:GL429821:1364144:1421282:1 gene:ENSMLUG00000001234 transcript:ENSMLUT00000001239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVRASLQKVTGSSDSVAAQNSEEFVLVPQHAGDTSTKDEEKPELKIVSNGDEQLEKAME
EILRDSEKGQGSLLVDRQSSSEISDHSLGDVSASQTNKPSLQLILDPSNTEISALRPSSP
SGLPEEDSVLFNKLTYLGCMKVSSPRNEVEALRAMATMKSSSQYPFPVTLYVPNVPEGSV
RIIDQSSNVEIASFPIYKVLFCARGHDGTTESNCFAFTESSHGSEEFQIHVFTCEIKEAV
SRILYSFCTAFKRSSRQVSDVKDSVIPTPDSDVFTFSVSLEVKEDDGKAYFSPVPKDRDK
FYFKLKQGIEKKVVITVQQLSNKELAIERCFGMLLSPGRNVKNSDMHLLDMESMGKSYDG
RAYVITGMWNPNAPIFLALNEETPKDKRVYMTVAVDMVVTEVVEPVRFLLETVVRVYPAN
ERFWYFSRKTFTETFFMRLKQTEGKGHTSAGDAIYEVVSLQRESEKEEPVTPTSGGGPMS
PQEDEAEEESDNELSSGTGDVSKDCPEKILYSWGELLGRWHNNLGARPKGLFTLVKSGIP
EALRAEVWQLLADCHDNQAMLDKYRLLITK
Download sequence
Identical sequences G1NV55
ENSMLUP00000001136 ENSMLUP00000001136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]