SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001147 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001147
Domain Number 1 Region: 318-367
Classification Level Classification E-value
Superfamily UBA-like 1.15e-17
Family UBA domain 0.00012
Further Details:      
 
Domain Number 2 Region: 44-112
Classification Level Classification E-value
Superfamily RING/U-box 1.29e-17
Family ZZ domain 0.01
Further Details:      
 
Domain Number 3 Region: 1-29
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000378
Family PB1 domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001147   Gene: ENSMLUG00000001250   Transcript: ENSMLUT00000001250
Sequence length 371
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430184:366085:371575:1 gene:ENSMLUG00000001250 transcript:ENSMLUT00000001250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEDGDLVAFSSDEELTMAMAYVKDDLFRIYIKERKECRRDHRPPCAQEAPRNMVHPNVIC
DGCNGPVVGTRYKCSVCPDYDLCAGCEGKGMHREHSKLAFPSPFEGFPHSRWLRKLKHGH
FGWPAWEMGLPGNWSPRPPRAGDTQASPTANSEIKASGPSEDPSVNFLKNVGESVAAALS
PLGIEVDIDVEHGGKRSRLTPVSPGSSSAEERCSSQPGSCSSDSSKPDGAMEGAAQALAK
QMNKITLQSGVQPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPESEGPSSLDP
SQEGPTGLKEAAVYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALD
TIQYSKHPPPL
Download sequence
Identical sequences G1NV64
ENSMLUP00000001147 ENSMLUP00000001147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]