SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001157 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001157
Domain Number 1 Region: 17-114
Classification Level Classification E-value
Superfamily DEATH domain 1.41e-17
Family Caspase recruitment domain, CARD 0.024
Further Details:      
 
Domain Number 2 Region: 581-616
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000426
Family PDZ domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001157   Gene: ENSMLUG00000001258   Transcript: ENSMLUT00000001260
Sequence length 620
Comment pep:known_by_projection scaffold:Myoluc2.0:GL432252:8853:19036:1 gene:ENSMLUG00000001258 transcript:ENSMLUT00000001260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELHRTHSSLAALDEETLWEMTESHRHRIVRSICPSRLTPYLRQAKVLGQLDEEEVLHS
PRFTNSAMRVGHLLDLLRVRGKNGALAFLESLKFHNPDVYTLVTGLQPDVDFSTFSGLME
TSKLTACLAGAIGSLQEELSQEKGQREVLAQQCRRLQERLGQAEARAEGLQQLEADHGRM
KREVSAHFHEVLKLKDEMLNLSLHYSNALQEKELASTRCRGLQEEVLLRPRPTQNSLPAS
LGPPHLQSEPQESGVAGSLSGAPLQVPKAGGSTLRGLGLQHAEKDILEQSLDEALESKQE
MVDRIHSLRERAVAAERQRKQFWEEKEQTLLQFQKTKVDCEIYKEKVTALQSQVAELQKE
RDQAYSARDAAQVEIAQSLAEKDALRRKVFELTDQGCDLRQQLRQLQAESAQGPKQEAGP
REPWRRGKQRLVRMFAICRDDSDSSCISSSESQLWSDLSATPSRELVDSVRSSSPVPPSQ
LSLYKRATEDFREDPWSFSGFSEILEGDWGGCPAAKAADVDLDYEIVDRADLLESEHSPQ
LISRGPCVSASSVPVRRRPARKLPSQVTVLAFQGDALLEQMSVIGGNLTGIFIHRVTPGS
AADEMALRPGTQIVTVSFRA
Download sequence
Identical sequences G1NV73
ENSMLUP00000001157 ENSMLUP00000001157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]