SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001217 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001217
Domain Number 1 Region: 2777-2898,2930-3047
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.9e-28
Family Nucleotide and nucleoside kinases 0.078
Further Details:      
 
Domain Number 2 Region: 1819-2029
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.94e-27
Family Extended AAA-ATPase domain 0.026
Further Details:      
 
Domain Number 3 Region: 2444-2717
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.11e-22
Family Extended AAA-ATPase domain 0.076
Further Details:      
 
Domain Number 4 Region: 2049-2263
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000753
Family RecA protein-like (ATPase-domain) 0.058
Further Details:      
 
Domain Number 5 Region: 3229-3319
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000523
Family BAR domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001217   Gene: ENSMLUG00000001316   Transcript: ENSMLUT00000001326
Sequence length 4470
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430557:137863:200461:1 gene:ENSMLUG00000001316 transcript:ENSMLUT00000001326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLPEEVEVEVDAGCEDEVSASEGHEEEEGETKSLKVESMDKVSAKSGHSRASSMFQSVVS
TEDDSWVRARSEPRLVRLPKRTVRHIVDKTHLHVLCTPVPEEFLAQNVVFFLRNTKETIS
EASYMKEAMEIMPETLEYGILNANMLHFLRDIMYQVFLPALSFNQHKEASVSLTPGEMQD
SFDTETELLNAHGEAVEYHSVQLIRDEFLMNVQKFANNIQRTVQQLEGEIKLEMPSISVE
GEVSALAADPEIIESLEQCVINWLGQITVAVEGQLKKTPQGNGPLAEIEFWRERNATLSA
LYEQTKLPIVRKVLEVIKEADSLLVANLQPVLTDLFKLHMEASDNVRFLSTVERHFKNIT
HGSSFHVVLETIPSMMSALRMVWIISRHYNKDERMIPLMERIAWEIAERVCRVVNLRTLF
RENRANAQHKTLEAKNSLDMWKKAYFDTRAKIEASGREARWEFDRKRLFERTDYMATICQ
DLYDVLQVMEEFYNIFGPELKAVTGDPKRIDDVLCRVDNLVTPMESLTFDPFCIQSAHYW
KYVMDDFKIEVLIDIINKIFVQNHENPPLYKNHPPVAGAIYWERSLFYRIKHTILRFQEV
QEILDSERGEEVKQKYLEVGRTMKDYEERKYELWRDTTEQLLPTLMKKSLLMKITANPED
AAETSDRGITFAINFPFALREIINETKYLEQLGFPVPELARNVALQEDKFLRYTEGIQHM
LDHYHMLVRTLNDAESSLLDDHSQELLRVFRSGFKRLNWNSLGIADYITRCKQAIGKFES
LVHQIHKNADDIASRLTLIESINLFKYPAPKTEEDLPGVKEFFEHIDRERTKDVDYMVRW
YLAIGPLLTKVEGLVIHTNTGKAPKLATYYEYWEKRVYEVLTKLILKNLQAFNSLILGNA
PLFQTETILTAPEIILHPNASEIDKMCVHCARNCVEVTRNFVRWMNGSCIECPPQKGEEE
EVVTITFYNDISLNPQIIEQALMIPQNVHRILVNLTKYLQKWKKYRPLWKLDKAIVMEKF
AAKKPPCVSYDEKLQFYTKISQEVMRQPLVKEEHCVRLQLGPLAHTVQESAKAWVMSLGK
LLNESAREELHSLHEEMESLAKNLKKSPGTLEDLKFVLATIAEVRSKSLVMELRYRDVQE
RYRTMAMYNLHPTNAEKELVDKIESMWQDLFTDSVNVEHALGSIKRTFTEITRSEIMNFR
QQMEDFAKRFYSEGPGSVGEDLDSGMDLLGSFERELVRHERNRQELANAEKLFDLPITMY
PELLKVQKEMTGLRMIYELYEELKVAKEEWSQTLWINLNVQFLQEGIEGFLRSLRKFPRM
VRNLAVAFHLEAKMKAFKDSIPLLLDLKHEALRDRHWKELMEKTGVYFEMTETFTLENMF
AMELDKHADVLNEIVTAAIKEIAIEKAVKEILDTWENMKFSVVKYFKGTQERGYILGSVD
EIIQCLDDNTFNLQSISGSRFVGPFLQTVHKWEKTLSLIGEVIEIWMLVQRKWMYLESIF
IGGDIRSQLPEEAKKFDNIDKVFKRIMGETLKDPVIKRCCEAQNRLSDLQHISEGLEKCQ
KSLNDYLDSKRNAFPRFFFISDDELLSILGSSDPLCVQEHMIKMYDNIAALRFQDGDSGE
KLVSAMISAEGEVMEFRKTVRAEGRVEDWMTAVLNEMRRTNRLITKEAIFRYCEDRSRVD
WMLLYQGMVVLAACQVWWTWEVEDVFHQVQAGEKHAMKSFGRKMHRQIDELVTRITLQLG
KNDRKKYNTELIIDVHARDIVDSFIRGSILDAQEFEWESQLRFYWDREPDELNIRQCTGT
FGYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGL
LCVVTNCGEGMDYKAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALMHQ
LTTFQFEGQEISLDSRMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDMQQICEIMLF
SEGFLWAKTLAKKMTVLYKLAREQLSKQHHYDFGLRALKSVLVMAGELKRGSSELKEDVV
LMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPSFNDAVEQVFEENGFVVLPV
QVDKVIQVYETMLTRHTTMVVGPTGGACVRRRPIYRASTLRLGLTTKLYILNPKAVSVIE
LYGILDPSTRDWTDGVLSNIFREINKPTDKKERKYILFDGDVDALWVENMNSVMDDNKLL
TLANGERIRLQAHCALLFEVGDLQYASPATVSRCGMVYVDPKNLKYQPYWKKWLQQIQNK
VEQVVLQNLFEKYVPYLIDVIVEGIVDGRQGEKLKMIVPQTHLNMVTQLTKVLDAFLEGE
IEDPDLLECFFLEALYCSLGACLLDFGRNRFDECIKRLASLPSAELDGVWARPGELPAQL
PTLYDFHFDPAQKRWIPWSKLVPEYVHSRERRFIEILVHTVDTTRTAWMLERMVKIKHPV
LLVGESGTSKTATTQNFLKNLSEETNIVLMVNFSSRTTSLDIQRNLEANVEKRTKDTYGP
PMGKRLLVFMDDMNMPKVDEYGTQQPIALLKLLLEKGFLYDRGKELNCKSIRDLGFIAAM
GKAGGGRNEVDPRFLSLFSVFNVPFPSEMSLHLIYFSILRGHTSVFHESIVAVSDRLTRC
TLQLYTDIVQELPPTPSKFHYIFNLRDLSRVFHGLVLTNPERFQTVAQMVRVWRNECLRV
FHDRLINEDDKALVQEYISDLVTEHFKDDVEVVMRDPILFGDFRMALHEEEERIYEDIQD
YEAAKALFQEILEEYNESNTRMDLVLFDDALEHVTRVHRIIRLDRGHALLVGVGGSGKQS
LAKLAAFTAGYEVFEILLSRGYSESNFREDLKNLYLRLGIENKTTIFLFTDAHVVEEGFL
ELINNMLTSGMVPALFAEDEKETILSQIDQEALKQGVSPAKESVWQYFVNKSANNLHIVL
GMSPVGDALRTWCRNFPGLVNNTGIDWFMPWPPQALHAVAKSFLGPNTMIPEEHIEDLVE
HVVLVHGSVGEFSKQFLQKLRRSNYVTPKNYLDFINTYSKLLDEKTQNNIAQCKRLEGGL
DKLKEASIQLDELNRKLAEQKIVLAEKSAACETLLDEIVTNTATAEEKKKLAEEKAIDIE
EQNKIIAVEKAEAETALAEVMPILEAAKLELQKLDKSDVTEIRSFAKPPKQVQTVCECIL
IMKGYKELNWKTAKGMMSDPNFLRSLMEIDFDSITQGQVKNIRSLLKTLNTTIEEMEAVS
KAGLGMLKFVEAVMSYCDVFKEIKPKREKVARLERNYFLTKRELEKIQNELAALQRELEA
LGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENIRWLRDLDELMHRRVRLLGD
CLLCAAFLSYEGAFTWEFRNEMVNQVWQQDITEREIPLSVPFRLESLLTDEVEISRWGSQ
GLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIKRKEEKNNLRVASFNDPDFLKLLEM
SIKYGTPFLFHDVDEYIDPVIDNVLEKNIKFSQGRQFIILGDKEVDYDSNFRLYLTTKLA
NPRYTPSVFGKAMVINYTVTLKGLEDQLLSVLVAFERHELEEQREHLIQETSENKNLLKD
LEDSLLRELATSTGNMLDNVELVQTLEETKSKATEVSEKLKLAEKTALDIDRLRDGYRPA
ARRGAILFFVLSEMALVTTMYQYSLSAFLDVFGLSLKKSLPDSILMKRLRNIMDTLTFNI
YNYGCTEKNLGCTILFSRGCGGCPSSTAEPGPPAAAPRPRLLPRAVVACVGSHAAAHTAL
SVRCPRGDPPGPPRDGASAFQWYDLDALEQSPFPLGYDSSITPFQKLLILRCFRVDRVYR
AVTDYVTVTMGEKYVQPPMISFEAIFEQSTPNSPIVFILSPGSDPASDLMKLAEQTGFGG
NRLKFLAMGQGQEKVALQLLETAVARGQWLMLQNCHLLVKWLKDLEKSLERITKPHPDFR
LWLTTDPTQGFPIGILQKSLKVVTEPPNGLKLNMRATYFKISNEMLEHCPHPAFKPLVYV
LAFFHAVVQERRKFGKIGWNVSYDFNESDFQVCMEILNTYLTKAFQQRDTRIPWGSLKYL
IGEVMYGGRAIDSFDRRILTIYMDEYLGDFIFDTFQPFHFFHNKEVDYKIPAGAGDPKER
FVEAIEALPLANTPEVFGLHPNAEIGYYTQAARDLWSHLLELQPQTGESSSGISREDYIG
NVAKDIENKMPKVFDLDLVRRHLGASITPTSVVLLQELERFNKLLVRMSRSLAELQRALA
GEVGMSSELDDVARSLFIGNIPHIWRKLAPDTLKSLGNWMLYFLRRFSQYTSWVVESEPN
VMWLSGLHVPESYLTALVQATCRRNGWPLDRSTLFTQVTKFQDADEVTERAGQGCFVSGL
YLEGADWDLERGCLVKSKPKVLVVDLPILKIIPIEAHRLKLQNTFRTPVYTTSTRRNAMG
VGLVFEADLFTTRHISHWVLQGVCLTLNSD
Download sequence
Identical sequences G1NVC6
ENSMLUP00000001217 ENSMLUP00000001217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]