SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001230 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001230
Domain Number 1 Region: 507-697
Classification Level Classification E-value
Superfamily Sec7 domain 6.15e-66
Family Sec7 domain 0.00000468
Further Details:      
 
Domain Number 2 Region: 729-853
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000133
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001230   Gene: ENSMLUG00000001338   Transcript: ENSMLUT00000001339
Sequence length 1115
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429788:7668498:7708023:-1 gene:ENSMLUG00000001338 transcript:ENSMLUT00000001339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLSSLFYSVEGEAPSSETCTSLDSPSAYHQDPLAPGSSLSPDHYEHTSVGAYGLYSGPLG
QRTRRPKLQHSTSILRKQAEEEAIKRSRSLSESYELSSDLQDKQVEMLERKYGGRLVTRH
AARTIQTAFRQYQMNKNFERLRSSMSENRMSRRIVLSNMRMQFSFEGPEKMHSSYFEGKQ
VSVTDDGSQLGALVPSEGSDFGEPPSLKSSAPSSDFADAITELEDAFSRQVKSLAESIDD
ALNCRSLHAEETPVPDTGRARDTEPQAALHTVDHHKLDEMTASYSDVTLYIDEEELSPPL
PLSQVGHRSSSAELDLQLRAGGAAQEYWALAHKDDKGDTDTSCQSTPSLEQQEQRLRVEH
LPLLTIEPPSDSSVDLSDRSERGSLKRKSAYERSLSGQQGSPKPGPHCGPPKGLPREEPE
LRARPSRPLDSHLAINGSANRQSKSESDYSDGDNDSINSTSNSNDTINCSSESSSRDSLR
EQTLSKQTYHKETRNSWDSPAFSNDVIRKRHYRIGLNLFNKKPEKGIQYLIERGFVPDTP
VGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVVDEMDFSAMELDEALRKFQAHIR
VQGEAQKVERLIEAFSQRYCICNPGVVRQFRNPDTIFILAFAIILLNTDMYSPNVKPERK
MKLEDFVKNLRGVDDGEDIPRETLIGIYERIRKRELKTNEDHVSQVQKVEKLIVGKKPIG
SLHHGLGCVLSLPHRRLVCYCRLFEVPDPNKPQKLGLHQREIFLFNDLLVVTKIFQKKKN
SVTYNFRQSFSLYGMQVLLFESQYYPNGIRLTSAVPGADIKVLINFNAPNPQDRKKFSDD
LRESIAEVQEMEKHRIESELEKQKGVVRPSMSQCSSLKKESGTGTLNRACLDDSYASSEG
LKRSALSSSLRDLSEAGKRGRRSSAGSLESNVEGSIISSPHMRRRATSTRECPSRPHQTM
PNSSSLLGSLFGSKRGKPPPQAHPPSAPPQPPPHPLGLPHPQHSMVGHHQGPAEGPPQVP
THGHHTQYCHVQQNPPPYHHHHHYHPPQHIQHAHQYHHGPHGGHVPYGAHTHSHPPLPLA
HASHPGHAAHHHGHSSAPPPPPSNKAKPSGISTIV
Download sequence
Identical sequences G1NVD9
ENSMLUP00000001230 ENSMLUP00000001230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]