SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001231 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001231
Domain Number 1 Region: 122-276
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 6.18e-19
Family AlkB-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001231   Gene: ENSMLUG00000001337   Transcript: ENSMLUT00000001340
Sequence length 393
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430280:488205:508203:1 gene:ENSMLUG00000001337 transcript:ENSMLUT00000001340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAASGYTDLREKLKSMTSRDNYKAGSREAAAAAAAAVAAAAAAAAAAEPYPLPGAKRKY
QEDSDPERSDYEEQQLQKEEEARKVKSGIRQMRLFSQDECAKIEARIDEVVSRAEKGLYN
EHTVDRAPLRNKYFFGEGYTYGAQLQKRGPGQERLYPPGDVDEIPEWVHQLVIQKLVEHR
VIPEGFVNSAVINDYQPGGCIVSHVDPIHIFERPIVSVSFFSDSALCFGCKFQFKPIRVS
EPVLSLPVRRGSVTVLSGYAADEITHCIRPQDIKERRAVIILRKTRLDAPRLETKSLSSS
VLPPSYASDRLSGNNRDPALKPKRSHRKADPDAAHRPRILEMDKEENRRSVLLPTHRRRG
SFSSENYWRKSYESEDCSEAAGSPTRKVKMRRH
Download sequence
Identical sequences G1NVE0
ENSMLUP00000001231 ENSMLUP00000001231 XP_006103908.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]