SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001358 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001358
Domain Number 1 Region: 662-726
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-20
Family SH3-domain 0.00068
Further Details:      
 
Domain Number 2 Region: 730-787
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-20
Family SH3-domain 0.00078
Further Details:      
 
Domain Number 3 Region: 491-552
Classification Level Classification E-value
Superfamily SH3-domain 7.09e-17
Family SH3-domain 0.00098
Further Details:      
 
Domain Number 4 Region: 566-642
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000236
Family SH3-domain 0.0019
Further Details:      
 
Domain Number 5 Region: 400-486
Classification Level Classification E-value
Superfamily SH3-domain 0.00000294
Family SH3-domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001358   Gene: ENSMLUG00000001478   Transcript: ENSMLUT00000001479
Sequence length 788
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429768:19514818:19566174:-1 gene:ENSMLUG00000001478 transcript:ENSMLUT00000001479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIMNTERSQNSIVSRIKALDSQTNTETSELPKKPEIAPRSLPPRPAVPSGKPSVAPKPA
ANRASGELDSWNENRRKVASGEGPTPHSPPQEVGSIPVTKPELPKKPNPGLTRSVNHETL
GGGPVVESPDGRKRVPTPAPRPLLPKKSLSSENPSCPAALLKPVTVPPRPPVASQAKAFR
SLGEGASASPAAPGLQSKPLGDIDLISFDDDVLPIPPGNVVEDSLGSEMALVDPFQVPTK
TEPTKEPAVQPAPTRKPTVIRIPAKPGKCLHEDPQSPPPLPIEKPIGNTYSTISGKPSNV
DRTRDLESDQAGQMGGSVQGPPRLPPRPINGKVTPARQPPPKGAPERPPPPRVSATRTSN
KKLPLNRSSSDMDLQKKQNNVASRLTKTKSQFFKSEDPVLPPRPKPGHPLYRKYMLSVPH
GIANENIVSNPGELSCKRGDGLVLLKQAENNYLECQKGKVTGRVHLSQMKIITPLDEHLR
SRPNDPSHTQKPVDSSAPHAVILHDFPAEQVGDLNLTSGEIVYLLEKIDTDWYRGKCRNQ
TGVFPANHVKVIIDVPGGGNGKRESVSSHCVNKGPRCGAQFEYIGDQKDVLSFLEGESIV
PNEYVNEEWAGGEPRGRTRISPLNLVELVEDHPTSGTNVFSTKVPLKTKKEDSGANSQDN
SLSGEWCEALHSFTAETSDDLPFRRGERILILQRLDSDWYKGRLRDREGIFPAVFVRPCP
ADMKSMSPLALKGRKAKALYDFHGDNEDELSFKAGDTITELESVDDDWMSGELMGKSGIF
PKNYVQVL
Download sequence
Identical sequences G1NVP8
ENSMLUP00000001358 ENSMLUP00000001358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]