SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001366 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001366
Domain Number 1 Region: 331-536
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.38e-59
Family Nucleotide and nucleoside kinases 0.00011
Further Details:      
 
Domain Number 2 Region: 169-316
Classification Level Classification E-value
Superfamily SH3-domain 9.45e-30
Family SH3-domain 0.00089
Further Details:      
 
Domain Number 3 Region: 95-186
Classification Level Classification E-value
Superfamily PDZ domain-like 1.03e-20
Family PDZ domain 0.00081
Further Details:      
 
Domain Number 4 Region: 36-87
Classification Level Classification E-value
Superfamily L27 domain 0.00000000000436
Family L27 domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001366   Gene: ENSMLUG00000001486   Transcript: ENSMLUT00000001487
Sequence length 541
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430435:74102:194869:1 gene:ENSMLUG00000001486 transcript:ENSMLUT00000001487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLFRMFNDQFLFAMIKIIYEKLHYYERQNPVPILHSAAALADDLAEELQNKPLNSEIREL
LKLLSKPNVKALLSVHDTVAQKKYDPVLPPMPDDIDDEEDSVKIIRLVKNREPLGATIKK
DEQTGAIIVARIMRGGAADRSGLIHVGDELREVNGIPVEDKKPEEIIQILAQSQGAITFK
IIPSIKEETPSKEGKMFIKALFDYDPNEDKAIPCKEAGLSFKKGDILQIMSQDDAMWWQA
KHEGDANPRAGLIPSKHFQERRLALRRPEIIVQPLKISNRKSSGFRRSFRLSRKDKKTNK
TMYECKKSDQYDTADVPTYEEVTPYRRQMNEKYRLVVLVGPVGVGLNELKRKLLISDTQH
YGVTVPHTTRARRSQESDGVEYIFISKHLFETDVQNNKFIEYGEYKNNYYGTSIDSVRSV
LAKNKVCLLDVQPHTVKHLRTLEFKPYVIFIKPPSIERLRETRKNAKIISSRDDQGTAKP
FTEEDFQEMIKSAQIMESQYGHLFDKIIVNDDLTMAFKELKTTFDKLETETHWVPVSWLH
S
Download sequence
Identical sequences G1NVQ5
ENSMLUP00000001366 ENSMLUP00000001366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]