SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001381 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001381
Domain Number 1 Region: 298-621
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 9.94e-127
Family Mammalian PLC 0.0000000415
Further Details:      
 
Domain Number 2 Region: 154-297
Classification Level Classification E-value
Superfamily EF-hand 1.24e-41
Family EF-hand modules in multidomain proteins 0.00042
Further Details:      
 
Domain Number 3 Region: 639-765
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.25e-30
Family PLC-like (P variant) 0.0001
Further Details:      
 
Domain Number 4 Region: 15-127
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-26
Family Pleckstrin-homology domain (PH domain) 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001381   Gene: ENSMLUG00000001505   Transcript: ENSMLUT00000001505
Sequence length 766
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429770:18243167:18265333:1 gene:ENSMLUG00000001505 transcript:ENSMLUT00000001505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDSERPGLVLSGDDQDVLLMQKGTMMRKVRSKNWKKLRYFRLKEDGMTVWHARQNILKCH
KCIIISISDVETVRNGHESEVLRSLAEEFPLEQGFTIVFHGRRSNLDLVANSVEEAQIWM
KGLQLLVDFVTNMDQQERLDQYRWRGWDCVNNRGDKNQDGRMSFHEVQRLLRLMNVEMEQ
EHAFQLFQAADTSQSDTLEGQEFIEFYKALTKRVEVLELFGNFSADGQKLTLLEFVDFLQ
EEQKEGDHASDLALELIDRHEPSESGKLRHVLSMDGFLSYLYSKDGDIFNPSCLPIYQDM
TQPLNHYYINSSHNTYLVGDQLCGQSSVEGYIRALKRGCRCVEVDVWDGPSGEPVVYHGH
TLTSRILFKEVVATLAQYAFQTSDYPVILSLENHCSFEQQEIIAHHLTEILGDQLLSTTL
DGQLPTQLPSPEELQKKILVKGKKLSTLEEDLEEEEELETELEGEQEPELEPQFESETQE
LSPRSKDKNEKKSKAILCPSLSALVIYTKTVSFYNFTHSREHYRFYELSSFSETKAKNLI
KETGNEFVQHNAWQLSRVYPSGLRTDSSNYNPQEFWNAGCQMGPSVAMNVQTAGLEMDIY
DGLFRQNGGCGYVLKPEFLRDTHSSFHPERPISPFKAQTLQIQVISGQQLPKVDKTKEGS
IVDPLVRVEIFGVRPDTTRQETSYVENNGFNPYWGQTLCFHLLVPELAMLRFLVKDYNWT
SRNDFIGQYTLPWTCMQQGYRHIHLLSKDGTSLHPASLFVHICMLE
Download sequence
Identical sequences G1NVR8
ENSMLUP00000001381 ENSMLUP00000001381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]