SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Myotis lucifugus 76_2.0 > ENSMLUP00000001397

Domain assignment for ENSMLUP00000001397 from Myotis lucifugus 76_2.0

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSMLUP00000001397
Domain Number 1	Region: 89-183
Classification Level	Classification	E-value
Superfamily	PDZ domain-like	9.6e-30
Family	PDZ domain	0.01
Further Details:

Domain Number 2	Region: 10-66
Classification Level	Classification	E-value
Superfamily	L27 domain	5.1e-22
Family	L27 domain	0.00027
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSMLUP00000001397 Gene: ENSMLUG00000001526 Transcript: ENSMLUT00000001522
Sequence length	220
Comment	pep:known_by_projection scaffold:Myoluc2.0:GL429776:4588777:4724037:-1 gene:ENSMLUG00000001526 transcript:ENSMLUT00000001522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMH ETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIY ISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVL EEMEARFEKLRTARRRQQQQLLIQQQQQQQQQQAQQNHMS
Download sequence
Identical sequences	G1NVT1 ENSMLUP00000001397 XP_005884219.1.60319 XP_006084030.1.53796 XP_006774776.1.95426 XP_008142033.1.99482 ENSMLUP00000001397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]