SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001413 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001413
Domain Number 1 Region: 264-364
Classification Level Classification E-value
Superfamily SH2 domain 1.31e-27
Family SH2 domain 0.00034
Further Details:      
 
Domain Number 2 Region: 188-290
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-22
Family SH3-domain 0.0000802
Further Details:      
 
Domain Number 3 Region: 111-168
Classification Level Classification E-value
Superfamily SH3-domain 5.51e-22
Family SH3-domain 0.00065
Further Details:      
 
Domain Number 4 Region: 5-61
Classification Level Classification E-value
Superfamily SH3-domain 5.78e-17
Family SH3-domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001413   Gene: ENSMLUG00000001544   Transcript: ENSMLUT00000001538
Sequence length 377
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429775:8222289:8291352:1 gene:ENSMLUG00000001544 transcript:ENSMLUT00000001538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSVNKTGFVPSNYVERKN
SARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAE
REDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSEKLA
AVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVLEKPENDPEWWKCRKINGMVG
LVPKNYVTIMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERG
HEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAP
IFTSEQGEKLYLIKHLS
Download sequence
Identical sequences G1NVU5 S7PDU7
ENSMLUP00000001413 XP_005863597.1.60319 XP_005863598.1.60319 XP_006083798.1.53796 XP_014306460.1.53796 XP_014306461.1.53796 XP_014306463.1.53796 ENSMLUP00000001413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]