SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001461 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001461
Domain Number 1 Region: 274-617
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.66e-88
Family Protein kinases, catalytic subunit 0.000000021
Further Details:      
 
Domain Number 2 Region: 83-210
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.69e-37
Family Synaptotagmin-like (S variant) 0.00000105
Further Details:      
 
Domain Number 3 Region: 25-80
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.04e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001461   Gene: ENSMLUG00000001590   Transcript: ENSMLUT00000001590
Sequence length 632
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429867:3092483:3170703:1 gene:ENSMLUG00000001590 transcript:ENSMLUT00000001590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFLTFTCGWAGGPGEGRGQPTKDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDT
CDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVQDAKNLIPMDPNGLSDP
YVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSIEIWDWDRTTRND
FMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNAELRQKFEVVCSHPLR
LYPGKAKLGPAGNRAYGPSPDRRLSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEE
LYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGG
DLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFG
MCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQEQPPFDGE
DEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPGKRLGCGPEGERDVREHAFFRRID
WEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQADFEGFSYVNP
QFVHPILQSPDLIRFPRPVCRFSPSESCPHPN
Download sequence
Identical sequences G1NVY6
ENSMLUP00000001461 ENSMLUP00000001461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]