SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001462 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001462
Domain Number 1 Region: 36-159
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-34
Family Pleckstrin-homology domain (PH domain) 0.0000595
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001462   Gene: ENSMLUG00000001591   Transcript: ENSMLUT00000001591
Sequence length 1043
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429891:2396006:2459700:1 gene:ENSMLUG00000001591 transcript:ENSMLUT00000001591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKQERNQRPSSMVSETSTTGTTSTVEAKPGPKIIKSSNKVHSFGKRDQAIRRNPNVPVV
VRGWLHKQDSSGMRLWKRRWFVLADYCLFYYKAKDSREEVVLGSIPLPSYVTSPVGPEDR
ISRKYSFKAEQSGMRTYYFSADTLEDMNAWVRAMNQAAQVLSRSSLKRVPFDVRHEIKEA
QTANVQVSPLFLRPPFLTPPKLAEGFALTECAVSDGRCCHHPHPSRGDFAKNHSAEARGP
SAGQACGSFILRPFSSLARPPGSGRQDAQPQRAEKNGIAYGPGEQNGTGGYPRAFPPRAN
HEKHSQRKSSLAQVEHWAKSQKGDGRSTEIKLTFKSFPPDQTLPRHGPSQPLSFPENYQT
LPRSTRHPSGGSSPPPRNLPSDYKYAQDRASHLKMSSEERRAHRDGTVWQLYEWQQRQQF
RHGSPTAPIPGPRQRPCRSDQIWIPNGDGCCPIRGVFLQPRILRLVLRSPWEGMLGRSKN
HSGEHSSSAECQRLGPPAGKPARGLSPSHITRPPSGSPCPFPVPQILAPDRSLKPMKIAE
SDIDVKLSIFCEQDRILQDLEDKIRALKENKDQLESVLEVLHRQMEQYRDQPQHLDKIAC
QQRLLQEDLVHIRAELSRESTEMENAWNEYLKLESDVAQLKQTLQEQKSPNNEKQNQKEK
SQIQKDLWRIEDVTAGLSANKENFRILVESVKNPGEWAVSWGPVPRQVGWSPGCQVLLCV
TPPGSRSWFHPILCFPLCPLERKTVPLFPHPPVPSLSTSESKPPPQPSPPTSPVRTPLEV
RLFPQLQTYLPYRPHPPQLRKVTSPLQSPTKTKPKGVRRSIGSTLTNGKCNSKRPKSALE
RLYSGDHQRGKMSAEEQLERMKRHQKALVRERKRTLSQGVSALKCQLPNPFHTVIGNWKR
EQDFDLQLLDRAVQGERKEEEENGWLKVQAVPVTELDLEPQDYDLDISRELSKPEKVSIP
ERYVDLEPEEPPSLEELQARYRKAEKIRSILTRSSMCNLQPASGQDRRNSVADLDSQIQE
QERIINISYALASEASQRSKQVA
Download sequence
Identical sequences G1NVY7
ENSMLUP00000001462 ENSMLUP00000001462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]