SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001465 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001465
Domain Number 1 Region: 343-693
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.01e-85
Family Protein kinases, catalytic subunit 0.00000167
Further Details:      
 
Domain Number 2 Region: 158-258
Classification Level Classification E-value
Superfamily MAST3 pre-PK domain-like 9.15e-46
Family MAST3 pre-PK domain-like 0.0000141
Further Details:      
 
Domain Number 3 Region: 929-1026
Classification Level Classification E-value
Superfamily PDZ domain-like 3.68e-18
Family PDZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001465   Gene: ENSMLUG00000001587   Transcript: ENSMLUT00000001595
Sequence length 1610
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429989:695325:737875:-1 gene:ENSMLUG00000001587 transcript:ENSMLUT00000001595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRTSNRKSLIVTSSTSPTLPRPHSPLHGHTGNSPLDSPRNFSPNAPAHFSFVPARRTDGR
RWSLASLPSSGYGTNTPSSTVSSSCSSQEKLHQLPFQPTADELHFLTKHFSTESVPDEEG
RQSPAMRPRSRSLSPGRSPVSFDSEIIMMNHVYKERFPKATAQMEERLAEFISSNTPDSV
LPLADGALSFIHHQVIEMARDCLDKSRSGLITSQYFYELQENLEKLLQDAHERSESSEVA
FVMQLVKKLMIVIARPARLLECLEFDPEEFYHLLEAAEGHAKEGQGIKCDIPRYIVSQLG
LTRDPLEEMAQLSSYDSPDTPETDDSVEGRGASLTSKKAPCEEDFETIKLISNGAYGAVF
LVRHKSTRQRFAMKKINKQNLILRNQIQQAFVERDILTFAENPFVVSMFCSFETKRHLCM
VMEYVEGGDCATLLKNIGALPVDMVRLYFAETVLALEYLHNYGIVHRDLKPDNLLITSMG
HIKLTDFGLSKIGLMSLTTNLYEGHIEKDAREFLDKQVCGTPEYIAPEVILRQGYGKPVD
WWAMGIILYEFLVGCVPFFGDTPEELFGQVISDEIVWPEGDDALPPDAQDLTSKLLHQNP
LERLGTGSACEVKQHPFFTGLDWTGLLRQKAEFIPQLESEDDTSYFDTRSDRYHHVDSED
EEEVSEDGCLEIRQFSSCSPRFSKVYSSMERLSLLEERRTPPPTKRSLSEEKEDRSDGLA
GLKGRDRSWVIGSPEILRKRLSVSESSHTESDSSPPLTVRRHCSGLLDVPRFPEGPEEAT
STPRRQQQEGIWLLTPTSAEGMSEPIPERPVEQQLKLDEEPASQSSGSSPAMETRGRGTP
QLAEGATAKAISDLAVRRARHRLLSGDSIEKRTTRPISKVIKSASATALSLLIPTEHHTC
SPLASPMSPHSQSSNPSSRDSSPSRDFLPALSNSRTPIIIHRAGKKYGFTLRAIRVYMGD
LDVYTVHHMVWHVEDGGPASEAGLRQGDLITHVNGEPVHGLVHTEVVELILKSGNKLSIS
TTPLENTSIKVGPARRGSYKAKMARRSKRSRGKDGQESRKRSSLFRKITKQASLLHTSRS
LSSLNRSLSSGESGPGSPTHGHSLSPRSPTQGYRVTPDAVHSVGGNSSQSSSPSSSVPSS
PAGSGHTRPSSLHGLAPKLQRQYRSPRRKSAGSIPLSPLAHTPSPPPAASPQRSPSPLSG
HGTQALPAKLHVSPPLGRQLSRPKSAEPPRSPLLKRVQSAEKLAAALAASEKKLATSRKH
SLDLPHPELKKELPPREVSPLEVAGTRSVLSGKGVLPGKGVLQPAPSRALGTLRQDRAER
RESLQKQEAIREVDSSEDDADEGPENSQGVQEPSLVPNPEVGQDPPLRGAGEGEEEDAFL
PRDPRMEGPGDPQRKLGILQVFEEAASSLSPTPSLGGAGPTDPIPPEGCLKAPLLHTQAL
TALCPSSPGLIPTSGPPASSTPGGPGPWSWKFLLEGPERASISRKATTEGGLVSSQDLEA
TTPAHPENLSPRQEGKSWPPNAPGLAHPCQLSSQSWRWEPESAQIEKEEPALGITTVPEA
SGDRRQNLPCRSCPLTQEPGPNLLQRGRDPGAPHKHQDLAVATNELLKQT
Download sequence
Identical sequences G1NVZ0
ENSMLUP00000001465 ENSMLUP00000001465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]