SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001477 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001477
Domain Number 1 Region: 103-266
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000235
Family Tropomyosin 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000001477
Domain Number - Region: 11-62
Classification Level Classification E-value
Superfamily PH domain-like 0.00197
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001477   Gene: ENSMLUG00000001608   Transcript: ENSMLUT00000001608
Sequence length 278
Comment pep:known_by_projection scaffold:Myoluc2.0:GL431100:1566:12342:1 gene:ENSMLUG00000001608 transcript:ENSMLUT00000001608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGQWCLLEEEFLISIFFLSQVQFAEKFQEVKEAARLARDKSQEKIETSSNHSQESGCETP
SSAQASSVNGTDDEKASHASPVDTHLKSENNKLKIALTQSAANVKKWEIELQTLRESNAR
LTTALQESATSVEQWKRQFSICRDENDRLRHKIDELEEQCSEIHREKEKNTQLKRRIEDL
ESELREKETELKDLRKQSEIIPQLMSECEYVSEKLEAAEKDNQNLEDKVRSLKMDIEESK
YRQRHLKVELKNFLEVLDGKIDDLHDFRRGLSKLGTDN
Download sequence
Identical sequences G1NW02
ENSMLUP00000001477 ENSMLUP00000001477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]