SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001478 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001478
Domain Number 1 Region: 6-176
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.14e-70
Family Cyclophilin (peptidylprolyl isomerase) 0.00000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001478   Gene: ENSMLUG00000001606   Transcript: ENSMLUT00000001609
Sequence length 1461
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430175:511830:546646:-1 gene:ENSMLUG00000001606 transcript:ENSMLUT00000001609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAQDRPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYK
GSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNG
SQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLATKS
TKDVFEKKRKKPTHSEDSDSSSNSSSSSESSSESEIERERSRRRKHKRRPKVKHPKKRRK
EASSSEEPRNKHVVSPKGHSERSDNNGKRSVDSNAKREKPVVRPEEIPPVPENRFLLRRD
MPLVTVEPEPKIPDATPIVSDQKPSVSKSGRKIKGRGTIRYHTPPRSRSCSESDDDDSSE
TPPHWKEEMQRLRAYRPPSGEKWSKGDKLSDPCSSRWDERSLSQRSRSWSYNGYYSDLST
ARHSDGHHKKRRKDKKVKHKKKAKKQKHCRRHKQTKKRRIIVPSDIESSKSSTRRMKFPC
ERERRSRSSSLSSHHSSKRDWSKSDKGDQSSSTHSSRDSYRSKSHSQSYSRGSSRSRTPS
KSSSHSPSRSKSRSSSKSGHQRTASKSPKRTAPQLSENKPVKTEPLRATVPQNETILVQQ
PVVAEHIPVIPLSDSPPPSRWKPGQKPWKPSYERIQEMKAKTTHLLPIQSTYSLTNIKET
GSSSSYNKREKNSESDQSAYSKYSDRSSESSPRSRSRSSRSRSYSRSYTRSRSVASSHSR
SRSPSSRSHSRNKYSDRSQCSRSSSYSSVSSDAGRRAKRKFRSSGKNSTSHKRQSSSSEK
APCSKYTKGRDKSSCPRKYSESRSSLDYSSDSEHSGVQVTQSAQEKEKQVQMEMNNKREK
NRDEEKSKPERECPRSKKRTLKENLSDHFRSANKPKRKNYAGSKWDSESNSERDVTKSSK
KNSLPSSDKEEGEATSDSESEFGEIHIKAKPTTKSSTSSSLPDGNGAWKSSKQRSSTSDS
EGSYSNSENPRGKPRKHKHASKEALKREHTKKVKEKMKGKKDKKHKAPKRKQAFHWQPPL
EFGEEEEEESNEKQVTQESQEKKQASENSETTKGNIPQTEKPCEDSSLSDKQNAITILSD
TEQPANDESKLSISPTPSATEENVASSPPNIQHIEESVPGGVEDMFQADDNMEICTPDRS
SPAKVEGTSPLGNSRLDTPDTGIVVKQAEHPAAEVGKQGSSVSESPTVREVGKPDSSSAG
SASAVESTVRREAAERGQVSLLDNKWKPLQGVGNLAAPTATSSAVEVKALTAVPEMKPQG
LRIEIKSKNKVRPGSLFDEVRKTARLNRRPRNQESSSDEQTPSRDGDSQSRSPSRSRSKS
ETKSRHRTRSVSYSHSRSRSRSSTSSYRSRSYSRSRSRGWYSRGRTRSRSSSSRSYKSHR
TSSRSRSRSTSYDPHSRSRSYTYDSYYSRSRSRSRSQRSDSYHRGRSYNRRSRSCRSYGS
DSESDRSYSHHRSPSESSRYS
Download sequence
Identical sequences G1NW03
ENSMLUP00000001478 XP_006102363.1.53796 ENSMLUP00000001478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]