SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001519 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001519
Domain Number 1 Region: 447-629
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.98e-36
Family cAMP-binding domain 0.00093
Further Details:      
 
Domain Number 2 Region: 183-347,380-442
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.4e-35
Family Voltage-gated potassium channels 0.0034
Further Details:      
 
Domain Number 3 Region: 5-100
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.93e-19
Family Flavin-binding PAS domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001519   Gene: ENSMLUG00000001650   Transcript: ENSMLUT00000001655
Sequence length 1072
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429775:541247:714228:-1 gene:ENSMLUG00000001650 transcript:ENSMLUT00000001655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVAKGFPIVCSDGFCELAGFARTEVMQKSCSCKFLFGVETNEQLMLQIDKSLEEKTEFKG
EIMFYKKNGSPFWCLLDIVPIKNEKGDVVLFLASFKDITDTKVKITPEDKKEDKAKGRSR
AGTHFDSARRRSRAVLYHISGHLQRREKNKLKINNNVFVDKPAFPEYKVSDAKKSKFILL
HFSTFKAGWDWLILLATFYVAVTVPYNVCFIGNDDLSTTRSTTVSDIAVEILFIIADIIL
NFRTTYVSKSGQVIFEARSICIHYVTTWFIIDLIAALPFDLLYAFNVTVVSLVHLLKTVR
LLRLLRLLQKLDRYSQHSTIVLTLLMSMFALLAHWMACIWYVIGKMEREDNSLLKWEVGW
LHELGKRLESPYYGNNTLGGPSIRSAYIAALYFTLSSLTSVGFGNVSANTDAEKIFSICT
MLIGALMHALVFGNVTAIIQRMYSRWSLYHTRTKDLKDFIRVHHLPQQLKQRMLEYFQTT
WSVNNGIDSNELLKDFPDELRSDITMHLNKEILQLSLFECASRGCLRSLSLHIKTSFCAP
GEYLLRQGDALQAIYFVCSGSMEVLKDSMVLAILGKGDLIGANLSIKDQVIKTNADVKAL
TYCDLQCIILKGLFEVLDLYPEYAHKFVEDIQHDLTYNLREGHESDVISRLSNKSTVSQS
EPKGNGSINRRLPSIVEDEEEDEEEEEETASLSPIYTRGSSSTRNKKVGSNKSYLGLSLK
QLASGTVPFHSPIRVSSSNSPKTKQESDPPNHSKRKEKNLKLQLSTLNSAAPPDLSPRIV
DGIEDGNSSEESQTFDFGSERIRPEPRISPPLGDPEIGAAVLFIKAEETKQQIKKLNSEV
TTLAQEVSQLGKDMRSVMQLLENVLPPRQPARFCSLHTASAQPSRDSFQSRMAWGAHQPC
LHLQAGGAAYTQAQLCRGNVTSDIWSVDPSSVETSPQRTGAPEPNPAGSERAHSPNLDFS
PAHYPVVQEGHLQFLRCVSPHSDTTLTPLQSISATLSSSVCSSSETSLHLVLPSRSEAGS
SGQRAVSSFSLENLPGSWDREGLASISTEPLENFPLQVVTSTADVKDKAINV
Download sequence
Identical sequences G1NW39
ENSMLUP00000001519 ENSMLUP00000001519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]