SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001553 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001553
Domain Number 1 Region: 14-69
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000795
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000001553
Domain Number - Region: 162-212
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0134
Family Ubiquitin-related 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001553   Gene: ENSMLUG00000001692   Transcript: ENSMLUT00000001691
Sequence length 326
Comment pep:novel scaffold:Myoluc2.0:GL429899:1814239:1818094:-1 gene:ENSMLUG00000001692 transcript:ENSMLUT00000001691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQV
HKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADATNGSNEDRGEVADE
DKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLR
SKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQR
DGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSP
SGNHQSSFASRPRKSSVNGSSATSSG
Download sequence
Identical sequences G1NW68 L5M405 S7MSZ9
ENSMLUP00000001553 XP_005865940.1.60319 XP_005865941.1.60319 XP_005865942.1.60319 XP_005865943.1.60319 XP_006094344.1.53796 XP_006094345.1.53796 XP_006094346.1.53796 XP_006759995.1.95426 XP_008147080.1.99482 XP_014394851.1.60319 ENSMLUP00000001553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]