SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001569 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001569
Domain Number 1 Region: 375-612
Classification Level Classification E-value
Superfamily Ras GEF 8.89e-32
Family Ras GEF 0.01
Further Details:      
 
Domain Number 2 Region: 36-154
Classification Level Classification E-value
Superfamily SH2 domain 2.42e-25
Family SH2 domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001569   Gene: ENSMLUG00000001713   Transcript: ENSMLUT00000001714
Sequence length 675
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429877:3987977:4016119:-1 gene:ENSMLUG00000001713 transcript:ENSMLUT00000001714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGRGQGGEVTVDTVLQFSKERHVMDRTPERLKKELEEELLLSSEDLRSHAWYHGRIPRQV
SENLVQRDGDFLVRDSLSSPGNFVLTCQWKNLAHHFKIQQTVLRLSEAYSRVQYQFERES
FDSIPGLVRSYVGNRQPISQQSGAIIFQPINRTVPLRCLEERYGTSPGLAREGSLVEVGQ
GLRGCRESRRGPQAMSGLRSSSRCQSGSGCAHPHPHPSRSVRRCGMWGNPMPPQSSGVDT
SPCPNSPVFRTGSEPTLSPAVARRVSSDARAGEALRGSDSQLCPKPPPKPCKAPLLKAPP
SPSTWLHSEANYCELNPASATGCDRGARPPLCAQDSYVELLKAKQNGAPGPDAEAEFVMP
LLETASSFRPNDFVSKLLPPENKPLETAMLKRAKELFTSNDPKVIARHMLSEDCKVARIL
EVSEEMRRNMGVSSGLELITLPYGHQLRLDIIERHSTMAIGIAVDILGCTGTLEDRAATL
NRIIQVAVELKDSMGDLYSFSAIMKALEMPQITRLEETWTALRRQHTQTAILYEKQLKPF
SKALHEGRVCRLPDNISVPLLMPLVTLMERQAVIFEGTDTWEKNNESCEIMMNHLTTARL
VAEAAHSYRMNAERILEGFQPDEEMSEIIKTEFQMRLLWGSKGAQVNQAERYEKFNQILT
ALSRKLEPPVKQAEL
Download sequence
Identical sequences G1NW79
ENSMLUP00000001569 ENSMLUP00000001569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]