SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001574 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001574
Domain Number 1 Region: 52-178
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.4e-45
Family Regulator of G-protein signaling, RGS 0.000000878
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001574   Gene: ENSMLUG00000001720   Transcript: ENSMLUT00000001719
Sequence length 205
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430274:264332:268755:-1 gene:ENSMLUG00000001720 transcript:ENSMLUT00000001719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCKGLAGLPASCLRSAKDMKHRLGVLLQKSDSGEHGSSHSRRDKLVVCPRVSQEEVKKWA
ESLENLISHECGLAAFRAFLRSEHSEENVEFWLRCEEYKRTRSPSKLRPKAMKIYEEFIS
VQATQEVNLDSGTREQTHRNLLAPTATCFDEAQRKIFHLMEKDSYRRFLKSRFYLALADP
SGGASEKQQGAKRPADGPSLAPGSA
Download sequence
Identical sequences G1NW83
ENSMLUP00000001574 ENSMLUP00000001574 XP_006103836.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]