SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001577 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001577
Domain Number 1 Region: 69-162
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.5e-21
Family Ubiquitin-related 0.00000977
Further Details:      
 
Domain Number 2 Region: 463-539
Classification Level Classification E-value
Superfamily UBA-like 1.33e-19
Family UBA domain 0.0000814
Further Details:      
 
Domain Number 3 Region: 348-415
Classification Level Classification E-value
Superfamily UBA-like 0.0000000034
Family UBA domain 0.02
Further Details:      
 
Domain Number 4 Region: 432-469
Classification Level Classification E-value
Superfamily UBA-like 0.0000000911
Family UBA domain 0.025
Further Details:      
 
Domain Number 5 Region: 233-386
Classification Level Classification E-value
Superfamily TPR-like 0.00000128
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001577   Gene: ENSMLUG00000001722   Transcript: ENSMLUT00000001722
Sequence length 613
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430103:213658:237547:-1 gene:ENSMLUG00000001722 transcript:ENSMLUT00000001722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQKKYLQAKLTQFLREDRIQLWKPPYTDENKEVGLALKDLAKKYSDKLECCENEVEKII
EEIRCKAIERGTGNENYKTTGIATIEVFLPPRLRKDRKNLLETRLHITGRELRSKIAETF
GFQENYIKIVINKKQLQLGKALEEQGVTHNVKAMVLELKQSEEDARKNFQVEEEEQNEAE
LKEKRIQRTKRGLEILAERGEMVDSETTPYLEIANQTGRSIKIPPSERKALTLAMGYHEK
GRAFLKRKEYGIALPCLLDADKYFCECCRELLDTVDNYAVLQLDIVWCYFRLEQLECLDD
AEKKLNLAQKCFKNCYGENHQRLVHIKGNCGKEKVLFLRLYLLQGIRNYHSGNGEEACEY
LNKARQLFKELYIDPSKVHNLLQLGFTAQEARLGLRACDGNVDHAAIHITNRREELAQIR
REEKEKRRRRLENINSLKGMGYSTHAAKQALHQASGNLDAALKILLSNPHMWWFNDSDPN
INNNQESPSQENIDQLVYMGFDTGAAEAALRVFKGNVQLAAQTLAHNGGSLPPDLQLPVD
ESPSTPTTSLSDSAGTSGVSTDEDMETEAVNEILEDLPEHEEDYLDSTLEDEEIIIAEYL
SYVENIKSATKKN
Download sequence
Identical sequences G1NW85 S7NFV3
XP_005880141.1.60319 XP_006101056.1.53796 XP_006101057.1.53796 XP_014321867.1.53796 XP_014321868.1.53796 ENSMLUP00000001577 ENSMLUP00000001577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]