SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001636 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001636
Domain Number 1 Region: 40-62,99-379
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.54e-61
Family WD40-repeat 0.00015
Further Details:      
 
Domain Number 2 Region: 375-419
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000562
Family SOCS box-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001636   Gene: ENSMLUG00000001791   Transcript: ENSMLUT00000001792
Sequence length 421
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429924:570212:586542:1 gene:ENSMLUG00000001791 transcript:ENSMLUT00000001792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASFPPRVNEKEIVRSRTIGELLALAAPFDKKCGRENWTVAFAPDGSYFAWSQGYCTVKL
VPWSQCLTNFLLHGTKNITNSNSLRLSRQNSDGAQKNKPREHIIDCGDIVWSLAFGSSVP
EKQSRCVNIEWHRFKFGQDQLLLATGLSNGRIKIWDVYTGKLLLNLVDHTEVVRDLTFAP
DGSLILVSASRDKTLRVWDLKDDGNMMKVLRAHQNWVYSCAFSPDSSMLCSVGASKAVFL
WDMDKYTMIRKLEGHHHDVVACDFSPDGALLATASYDTRVYVWDPHTGDILMEFGHLFPP
PTPIFAGGANDRWVRSVSFSHDGLHIASLADDKMVRFWRIDEDYPVQVAPLSNGLCCAFS
TDGSVLAAGTHDGSVYFWATPRQIPSLQHLCRMSIRRVMPTQEVQKLPIPSKVLEFLSYR
I
Download sequence
Identical sequences G1NWD3
XP_006095559.1.53796 XP_006764109.1.95426 ENSMLUP00000001636 ENSMLUP00000001636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]