SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001660 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001660
Domain Number 1 Region: 168-353
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.99e-50
Family Nucleotide and nucleoside kinases 0.0000000177
Further Details:      
 
Domain Number 2 Region: 1-93,132-167
Classification Level Classification E-value
Superfamily SH3-domain 2.8e-34
Family SH3-domain 0.00000528
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001660   Gene: ENSMLUG00000001818   Transcript: ENSMLUT00000001819
Sequence length 549
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429888:1386199:1426818:-1 gene:ENSMLUG00000001818 transcript:ENSMLUT00000001819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TKPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIG
FIPSPVKLENMRLQHEQRAKQGKFYSSKLGGNSSSSLGDIVPSSRKSTPPSSAIDIDATG
LDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSL
KGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSL
AEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSR
GKSQAKHLNVQMVAADKLSQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPPSSNL
PNPLLSRTLATSALPVSPTPASNSQGSQGDQRTDRSALARSAPQAEEEPCLEPARKSQHR
PSSSAPHHNHRSGTHRGLSRQETFDSETQDSRDSAYVEPKEDYSHEHVDHYAPHRDHNHR
EEPHGSGEHRHRESRHRPRDLDREQDHNECNKQRSRHKSKDRYCDKDGEGISKKRNEAGE
WNRDVYIRQ
Download sequence
Identical sequences G1NWF6
ENSMLUP00000001660 ENSMLUP00000001660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]