SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001711 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001711
Domain Number 1 Region: 530-594,816-1170
Classification Level Classification E-value
Superfamily Ras GEF 8.89e-118
Family Ras GEF 0.000016
Further Details:      
 
Domain Number 2 Region: 129-352
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-42
Family DBL homology domain (DH-domain) 0.00024
Further Details:      
 
Domain Number 3 Region: 340-495
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000761
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000001711
Domain Number - Region: 2-62
Classification Level Classification E-value
Superfamily PH domain-like 0.00482
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001711   Gene: ENSMLUG00000001877   Transcript: ENSMLUT00000001881
Sequence length 1173
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429767:34983637:35102392:-1 gene:ENSMLUG00000001877 transcript:ENSMLUT00000001881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QYYFTVLFGHEGQKPLELRCEEQQDGKEWMEAIHQASYADILIEREVLMQKYIHLVQIVE
TEKIAANQLRHQLEDQDTEIERLKSEIIALNKTKERMRPYQSNQEEDDPDIKKIKKVQSF
MRGWLCRRKWKTIVQDYICSPHAESMRKRNQIVFTMVEAESEYVHQLYILVNCFLRPLRM
AASSKKPPISHDDVSSIFLNSETIMFLHEIFHQGLKARLANWPTLILADLFDILLPMLNI
YQEFVRNHQYSLQVLANCKQNRDFDKLLKQYEANPACEGRMLETFLTYPMFQIPRYIITI
HELLAHTPHEHVERKSLEFAKSKLEDLSRIMHDEVSDTENIRKNLAIERMIVEGCDILLD
TSQTFIRQGSLIQVPSVEKGKLSKVRLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHL
LKTGGVLSLIECTLIEESDASDDDSKGSGQVFGHLDFKIVVEPPGAAPFTVVLLAPSRQE
KAAWMSDISQCVDNIRCNGLMTIVFEENSKVTVPHMIKSDARLHKDDIDICFSKTLNSCK
VPQIRYASVERLLERLTDLRFLSIDFLNTFLHTYRIFTTAAQVLAKLSDIYKRPFTSIPV
RSLELFFATSQNSRGEHLVDGKSPRLCRKFSSPPPRAVSRTSSPVRARKLSLTSPLNSRI
GALDLTTASASSSPTTPHSPAASSPPHTVSALSTCTASSLPCKGSEEVTLVASVNPKIIK
LTGSKSHATAVLESAPVERAAVESSPAVDATELSPGRSPSTPRHLRYRQPGVSPIFIYEN
WLLLREPGQMADSSHCSVSPASAFAIATAAAGHGSPPENREIFQKFSKIEKRFNNTDRIC
DKEFIIRRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDPDLLPQERKAA
ANILRALSQDDQDDIHLKLEDIIQLTDCPKAECFETLPAMELAEQITLLDHIVFRSIPYE
EFLGQGWMKLDKNERTPYIMKTSQHFNDMSNLVASQIMNYADISSRANAIEKWVAVADIC
RCLHNYNGMLEITSALNRTAIYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKNLRETLK
NCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIVREIRQFQQTSYRIDH
QPKVTQYLLDKALIIDEDTLYELSLKIEPRLPA
Download sequence
Identical sequences G1NWJ9
ENSMLUP00000001711 ENSMLUP00000001711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]