SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001759 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001759
Domain Number 1 Region: 201-346
Classification Level Classification E-value
Superfamily PH domain-like 1.88e-45
Family Third domain of FERM 0.000000274
Further Details:      
 
Domain Number 2 Region: 88-200
Classification Level Classification E-value
Superfamily Second domain of FERM 9.55e-36
Family Second domain of FERM 0.00000102
Further Details:      
 
Domain Number 3 Region: 5-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.51e-26
Family First domain of FERM 0.00000842
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000001759
Domain Number - Region: 378-451
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0549
Family Myosin rod fragments 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001759   Gene: ENSMLUG00000001931   Transcript: ENSMLUT00000001932
Sequence length 478
Comment pep:novel scaffold:Myoluc2.0:GL430272:533407:552853:1 gene:ENSMLUG00000001931 transcript:ENSMLUT00000001932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPPGINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLQYVDNKGFPTWLK
LDKKVSAQEVRKENPLQFKFRAKFYPEDVPEELIQDITQKLFFLQVKEGILSDEIYCPPE
TAVLLGSYAVQAKFGDYNKEMHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAENR
GCSTNRDSAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKEDKLTPKI
GFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPD
TIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDYEQKT
KKAEKELSDQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQTVDQIKSQEQLA
AELAEYTAKIALLEEARRRKEDEVEEWQHRVSGAGRGRARLPEKGHPERSAPPGRPPP
Download sequence
Identical sequences G1NWP5
ENSMLUP00000001759 ENSMLUP00000001759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]