SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001760 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001760
Domain Number 1 Region: 344-400
Classification Level Classification E-value
Superfamily SH3-domain 0.0000916
Family SH3-domain 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000001760
Domain Number - Region: 97-127
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 0.0403
Family Ribosomal protein L40e 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001760   Gene: ENSMLUG00000001933   Transcript: ENSMLUT00000001933
Sequence length 413
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429811:4153914:4166290:-1 gene:ENSMLUG00000001933 transcript:ENSMLUT00000001933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTFCSVIKFENLQELKRLCHWGPIIALGVIAICSTMAMIDSVLWYWPLHTTGGSVNFIM
LINWTVMILYNYFNAMFIGPGFVPLGWKPENSQDSMYLQYCQVCQAYKAPRSHHCRKCNR
CVLKMDHHCPWINNCCGYQNHASFTLFLLLAPLGCIHAAFIFVMTMYTQLYNRLSFGWNT
VKIDMSAARRDPLPIIPFGLAAFAATLFALGLALGTTIAVGMLFFIQIKIILRNQTSIES
WIEEKAKDRIQYYQLDEVFVFPYDMGSRWKNFKQVFTWSGVPEGDGLEWPVREGCHQYSL
TIEQLKQKADKRVRSVRYKVIEDYSGACCPLNKGIKTFFTSPCTEEPRIPLQKGEFILAT
RGLRYWLYGDKILDDSFIEGVSRIRGWFPRNCVEKCPCDAETEQALEGEKKNR
Download sequence
Identical sequences G1NWP6
ENSMLUP00000001760 ENSMLUP00000001760 XP_006088192.1.53796 XP_006088193.1.53796 XP_006088194.1.53796 XP_014310759.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]