SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001761 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001761
Domain Number 1 Region: 4-187
Classification Level Classification E-value
Superfamily L domain-like 1.93e-36
Family Leucine rich effector protein YopM 0.012
Further Details:      
 
Domain Number 2 Region: 1245-1334
Classification Level Classification E-value
Superfamily PDZ domain-like 7.59e-23
Family PDZ domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001761   Gene: ENSMLUG00000001932   Transcript: ENSMLUT00000001934
Sequence length 1338
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430032:1325456:1460791:1 gene:ENSMLUG00000001932 transcript:ENSMLUT00000001934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEVLDQIQNLRELWMDNNALQVLPGSIGKLKMLVYLDMSKNRIETVDMDISGCEALEDLL
LSSNMLQQLPDSIGLLKKLTTLKVDDNQLTMLPNTIGNLSLLEEFDCSCNELESLPPTVG
YLHSLRTLAVDENFLPELPREIGSCKNVTVMSLRSNKLEFLPEEIGQMQKLRVLNLSDNR
NVSLIYNFSILKIFFILWRLSDRQSKALIPLQTEAHPETKQRVLTNYMFPQQPRGDEDFQ
SDSDSFNPTLWEEQRQQRMTVAFEFEDKKEDDDNAGKVKDHSCQAPWERGQRGITLQPAR
LSGDCCTPWARCDQQIQDMPVPQNDPQLAWGCISGLQQERSMCTPLPVAAQSTTLPSLSG
RQVEINLKRYPTPYPEDLKNMVKSVQNLVGKPSHGVRIENSNPTANTEQTVKEKYEHKWP
VAPKEITMEDSFVHPANDMRIGELHPSLAETPLYPPKLVLLGKDKKESTDESEVDKTHCL
NNSVSSGTYSDYSPSQASSGSSNARVKVGSLQTTAKDAVHSSLWGNRITQPFPQPLDSKP
LLSQREAVPPGNLPQRPDRLPMSDTFTDNWTDGSHYDNTGFVGEETTGENANSNPLLGSK
SRNPPAHGRRPLIRQDRIVGVPLELEQSANRHTPETEVPPSNPWQNWTRTPSPFEDRTAF
PSKLETTPTTSPLPERKEHMKDSVDIPSPFSPGLPWEYHDSNPNRSLGNVFSQIHCRPES
SKGIPISKSTERLSPLMKDIKSNKFKKSQSIDEIDIGTYKVYNIPLENYASGSDHLGSHE
RPDKLLGPEHGMSSMSRSQSVPMLDDEMLTYGGSKGPQPQKASMTKKVYQFDQSFNPQGA
VEVKADKRMPPPFQHNSEYMQPPGKSLAKDLISPRAYRGYPPMEQMFSFSQPSVNEDAVV
NAQFASQGARAGFLRRADSLVSATEMAMFRRVSEPHELPPSDRYGRPPYRGGLDRQSSVS
VTESQFLKRNGRYEDEHPSYQEVKAQAGSFPVKNLTQRRPLSARSYSTESYGASQTRPVS
ARPTMAALLEKIPSDYNLGNYGDKPSDNSDIKTRPTPVKGEESCGKMPADWRQQLLRHIE
ARRLDRNAAYKHNTVNLGMLPYGGISAMHAGRSMTLNLQTKSKFDLQELPLQKTPSQQSN
ILDNGQEDVSPSGQWNPYPLGRRDVPPDTITKKAGSHIQTLMGSQSLQHRSREQQPYEGN
INKVTIQQFQSPLPIQIPSSQATRGPQPGRCLIQTKGQRSMDGYPEQFCVRIEKNPGLGF
SISGGISGQGNPFKPSDKGIFVTRVQPDGPASNLLQPGDKILQANGHSFVHMEHEKAVLL
LKSFQNTVDLVIQRELTV
Download sequence
Identical sequences G1NWP7
ENSMLUP00000001761 ENSMLUP00000001761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]