SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001779 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001779
Domain Number 1 Region: 56-206
Classification Level Classification E-value
Superfamily PH domain-like 2.6e-25
Family Phosphotyrosine-binding domain (PTB) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001779   Gene: ENSMLUG00000001955   Transcript: ENSMLUT00000001955
Sequence length 404
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429781:1483612:1484945:-1 gene:ENSMLUG00000001955 transcript:ENSMLUT00000001955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPWKKHKFELLAEAPPRQASKPKGYAVSLHYSALSSLARACPEGALSRVGSMFRSKRKK
LHITSEDPTYTVLYLGNATTIQARGDGCTDLAVGKIWSKSEAGRQGTKMKLTVSAQGIRM
VHAEERALRRPGHLYLLHRVTYCVADARLPKVFAWVYRHELKHKAVMLRCHAVLVSKPEK
AQAMALLLYQTSANALAEFKRLKRRDDARHQQQELVGAHTIPLVPLRKLLLHGPCCYKPP
VERSPSAPKLGSITEDLVGEQQEEELQEEEEEEHTESCLEEEEEEEDRAREKGGLPGPFE
EWPGRRPWGGSGVLVGTRGGGPPLLLLGSSSDVKALSQLINGPGGSSASGNDVRSLQADL
RVTRLLSGESTRQREAAGPDATSATAGDQSGPTDRASPDEPRSG
Download sequence
Identical sequences G1NWR0
ENSMLUP00000001779 ENSMLUP00000001779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]