SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001786 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001786
Domain Number 1 Region: 43-334
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.3e-87
Family PhyH-like 0.000000000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001786   Gene: ENSMLUG00000001965   Transcript: ENSMLUT00000001963
Sequence length 337
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429789:226587:242883:-1 gene:ENSMLUG00000001965 transcript:ENSMLUT00000001963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGARAASRLRVVLGHLGCPSAGAVIAHPTSGAVPSASFHPQFQYTRDNNVLSLEQRKFY
EENGFLVIKNLVSDADIERFRNEFERLCRQEVKPAGLMLMKDVTIAKSKYAPSEKVITKA
QDFQEDEELFRYCTLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYF
PFRPSDSIVCAWTAMEHIDRNNGCLVVLPGTHKGTLKPHDYPKWEGGVNIMFHGIQDYDE
NNARVHLVMEKGDTVFFHPLLIHGSGQNRTQGFRKAISCHFASADCHYIDVKGTSQENIE
NEIVSLAEKLYGVKDGVSLKDVWRFRGRLVKGQRVNL
Download sequence
Identical sequences G1NWR6
ENSMLUP00000001786 ENSMLUP00000001786 XP_006085869.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]