SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001804 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001804
Domain Number 1 Region: 20-155
Classification Level Classification E-value
Superfamily ENTH/VHS domain 4.97e-48
Family VHS domain 0.000000313
Further Details:      
 
Domain Number 2 Region: 152-305
Classification Level Classification E-value
Superfamily GAT-like domain 1.7e-32
Family GAT domain 0.000005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001804   Gene: ENSMLUG00000001981   Transcript: ENSMLUT00000001983
Sequence length 412
Comment pep:novel scaffold:Myoluc2.0:AAPE02063058:2185:15952:-1 gene:ENSMLUG00000001981 transcript:ENSMLUT00000001983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEFIIWDPHAFVTCAFLSSEKATDGSLQSEDWALNMEICDIINETEEGPKDAFRAIKKRI
TGNKNFHEVMLALTVLETCVKNCGHRFHVLVASQDFVEGVLVRTILPKNNPPTIVHDKVL
NLIQSWADAFRSSPDLTGVVAVYEDLRRKGLEFPMTDLDMLSPIHTPQRTVFNSETPSGQ
NSAGTDTSHRGDPSQHAAPVSTPAVLPSDTPITPTPEQIGKLRSELEMVSGNVRVMSEML
TELVPTQAEPADLELLQELNRTCRAMQQRVLELIPRIANEQLTEELLIVNDNLNNVFLRH
ERFERFRTGQTAKAPSEAEAAADLIDMGADPAATGGLSSQLAGMNLGSSSVRAGLQSLET
SGRLEDEFDMFALTRGSSLADQRKEFPLLCAQCTKPLGGREAPDKSSGACPV
Download sequence
Identical sequences G1NWT2
ENSMLUP00000001804 ENSMLUP00000001804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]