SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001852 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001852
Domain Number 1 Region: 25-107
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.73e-24
Family Ubiquitin-related 0.0000338
Further Details:      
 
Domain Number 2 Region: 534-584
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000231
Family UBA domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000001852
Domain Number - Region: 206-256
Classification Level Classification E-value
Superfamily ARM repeat 0.000213
Family Mo25 protein 0.032
Further Details:      
 
Domain Number - Region: 393-448
Classification Level Classification E-value
Superfamily XPC-binding domain 0.0458
Family XPC-binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001852   Gene: ENSMLUG00000002036   Transcript: ENSMLUT00000002034
Sequence length 588
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430062:1319825:1363095:1 gene:ENSMLUG00000002036 transcript:ENSMLUT00000002034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESGESGGPPSSQDSAVAAEGTGAPAAAAAAEPKIMKVTVKTPKEKEEFAVPEDSSVQQ
FKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLVIKTQNRSQDHSAQQT
NTSGSNVTTSSAPNSNSTSGSAPSNPFGLGALGGLAGLSSLGLNSTNFSELQSQMQRQLM
SNPEMMVQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHMLNNPDIMRQTLE
LARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQEPMLSAAQEQFGGNPFASLV
SNTSSGEGSQPSRTENRDPLPNPWAPQASQSSSASIGTTNAVGGTGGSTASSTAGQSSAP
SLGPGVGASMFNTPGMQSLLQQITENPQLMQNMLSAPYMRSMMQSLSQNPDLAAQMMLNN
PLFAGNPQLQEQMRQQLPTFLQQMQNPDTLSAMSNPRAMQALLQIQQGLQTLATEAPGLI
PGFTPGLGTLGSTGGSSGTNGSSSAPSENPRPTEGTTEPGHQQFIQQMLQALAAVNPQLQ
SPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSQPS
Download sequence
Identical sequences G1NWX6
ENSMLUP00000001852 XP_006100081.1.53796 ENSMLUP00000001852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]