SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001866 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001866
Domain Number 1 Region: 135-342
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.55e-59
Family DBL homology domain (DH-domain) 0.00000000253
Further Details:      
 
Domain Number 2 Region: 334-488
Classification Level Classification E-value
Superfamily PH domain-like 1.1e-42
Family Pleckstrin-homology domain (PH domain) 0.000000105
Further Details:      
 
Domain Number 3 Region: 32-151
Classification Level Classification E-value
Superfamily SH3-domain 3.68e-21
Family SH3-domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001866   Gene: ENSMLUG00000002051   Transcript: ENSMLUT00000002049
Sequence length 557
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429771:8424957:8715731:-1 gene:ENSMLUG00000002051 transcript:ENSMLUT00000002049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYWRRRRKLCTGNLDHGFKTLESCKNIGGHWKPQGPGNKQSPKLITGDSIVSAEAVWDHV
TMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVRLWVNQEDGVEEGPSDVQ
NGHLDPNSDCLCLGRPLQNRDQMRANVINEIMSTERHYIKHLKDICEGYLKQCRKRRDMF
SDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEIGPCFLEHQDGFWIYSEYCNN
HLDACMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYT
AQDHSDYRYVAAALAVMRNVTQQINERKRRLENIDKIGQWKKIALWGQGGEDILDRSSEL
IYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKKDLIRRDILYYKGRIDMDKYEVVDIEDG
RDDDFNVSMKNAFKLHNKETEEVHLFFAKKLEEKIRWLRAFREERKMVQEDEKIGFEISE
NQKRQAAMTVRKVSKQKGVNSARSVPPSYPPPQDPLNQGQYLVPDGIAQSQVFEFTEPKR
SQSPFWQNFSRLTPFKK
Download sequence
Identical sequences G1NWY9
ENSMLUP00000001866 ENSMLUP00000001866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]