SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001897 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001897
Domain Number 1 Region: 849-997,1035-1139
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 7.55e-25
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001897   Gene: ENSMLUG00000002079   Transcript: ENSMLUT00000002084
Sequence length 1177
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430095:45198:58281:-1 gene:ENSMLUG00000002079 transcript:ENSMLUT00000002084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESTPSFLKDTPAWEKTAPENGIMGREPNALPRDGLRHGALCLGEPAPFWRGVLSTPNSW
LPPGFPQGPKDTLPLVEGEGPRNGERKASWLSGKEGLRWKEAMLTHPLALYGSACPPRYG
PLIPEHSSGHPKSDPVAFRPLHCPFLLETKILERAPFWVPTCLPPYLVSSLPPERPCDWP
LAPHPWVYSGGQPKVPSAFSLGSKGFYHKDPSIFRLAKEPLATVDPGLLGLAPGGPLQRS
GEAECPSLHPRDGETGLGRHQNLCPLLLGHPDTVPRTPWPTCPPGLVHTLGNVWTVPGGG
GLGYQLRPSTTSRCPSPGPPTTQVGCYSSHPPAGDGGLGPCGKCQEGLEGGARGSGESIE
EANKASGPRACLPNHHTKLKKTWLTRHSEQFGCPGGCPGDEESPAAPLQTLKRASSPEVQ
GVAGSPAAKRPPDPFPGSAGQDVLDSSPGNKAEAEQRADRRGPRDGRAGLQDPGRQDAPC
SAPPAGIAQCQSCAQAAGEVGGLACHSQQVPRSSLGGEQQEEDSAASSEEGGGSGPKAGP
SVGLAKHLLSGLGDRLCRLLRREREALAWAQREGQGPARTEDNPGVPGCCSRCHHGLFNT
HWSCPRCSHRLCVACGRMAGAGRAREKAGSPEQPTEECAQEAGHSASSLMLTQFVSSQAL
AELSTAMHQVWIKFDIREHCPCQADAQVWAPGDGGQQKEPREKNTPTPQPSCTEDTNRTK
DIKAETLDSTETPAKDRASRGPLPCPSLCELLASTAVKLCLGHERIHMAFAPVTPALPSD
DRITNILDSIIAQVVERKIQEKALGPGLRPGSALRKGLGLPLSPVRPRLPPPGALLWLQE
PRPRRGFHLFQEHWRQGQPVLVSGIQRTLQGSLWGTEALEALGGQVQALTPLGPPQPTNL
GTAAFWDGFSRPEIRPKSSEGSVLLLHRALRDEDTSRLENLAASLPLPEYCAQHGKLNLA
SYLPPGPALCPLEPQLWAAYGVSPHRGHLGTKNLCVEVTDLVSILVRAEAPLPAWHRAQK
DFLSGLDGEGLWSPGSQVSTVWHVFRAQDAQRIRRFLQMVCPAGAGNLEPGTPGSCYLDA
GLRRRLREEWGVSCWTLLQAPGEAVLVPAGAPHQVQGLVSTVSVTQHFMSPETSALSAQL
CHQGSSLSPDCRLLCAQVDWAVFQAVKLAVGTLREAK
Download sequence
Identical sequences G1NX16
ENSMLUP00000001897 XP_006100783.1.53796 ENSMLUP00000001897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]