SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001916 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001916
Domain Number 1 Region: 276-463
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.44e-43
Family cAMP-binding domain 0.00017
Further Details:      
 
Domain Number 2 Region: 32-267
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.58e-30
Family Voltage-gated potassium channels 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001916   Gene: ENSMLUG00000002105   Transcript: ENSMLUT00000002104
Sequence length 573
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429905:3490257:3495630:1 gene:ENSMLUG00000002105 transcript:ENSMLUT00000002104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QERNGAKNTSGWPLSPSSSRRTLPVLDPSGDYYYWWNTMVFPVMYNLIIIVCRACFPDLQ
HGYLVAWFVVDYTSDLLYLLDIVVRFHTGFLEQGILVVDKGRISSRYVRTWSFCLDLASL
VPTDVAYVRLGPHTPTLRLNRFLRVPRLFEAFDRTETRTAYPNAFRIAKLMLYIFVVIHW
NSCLYFALSQYLGFGRDPWVYPDPAEPGFERLRRQYLYSFYFSTLILTTVGDIPLPEREE
EFLFMVGDFLLAVMGFATIMGSMSSVIYNMNTADAAFYPDHALVKKYMKLQHVNRRLERR
VIDWYQHLRINKKMTNEVAILQHLPERLRAEVAVSVHLSTLSRVQIFQNCEASLLEELVL
KLQPQTYSPGEYVCRKGDIGREMYIIREGQLAVVADDGVTQYAVLGAGLYFGEISIINIK
GNMSGNRRTANIKSLGYSDLFCLSKEDLREVLSEYPQAQAVMEEKGREILLKMNKLDINA
EAAEIALQEATESRLRGLDQQLDDLQTKFARLLAELESSALKIAYRIERLEWQTREWPMP
EELAEADDEGESGEGTSKDEEGRASQEGPPGSE
Download sequence
Identical sequences G1NX33
ENSMLUP00000001916 ENSMLUP00000001916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]