SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001958 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001958
Domain Number 1 Region: 604-907
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.66e-53
Family WD40-repeat 0.0017
Further Details:      
 
Domain Number 2 Region: 1052-1106
Classification Level Classification E-value
Superfamily SH3-domain 9.58e-22
Family SH3-domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001958   Gene: ENSMLUG00000002136   Transcript: ENSMLUT00000002147
Sequence length 1144
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429778:12777478:12903622:1 gene:ENSMLUG00000002136 transcript:ENSMLUT00000002147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTVESEAKVKTEVHFEELLKTHNNQIYERKKLKKKIGTSGEKISNGEDEVSPNAHFILI
TYFIELDTVRSNPRKIKETESDEVIAANTNNTKKSMRVIKNRPSNPQSATENPGDEGSVQ
EDKQEQVNKITKTVCQVTTQEMEQETSEKVDFLHQKVQMRLQPGFADHRSEMANEEKGNN
LDEEEQLKQVYQLQVAEEMAKEIKKKIRKKLKEQLTDFPSDTCLHDDKLSSEKKRKKKKK
APILPDAETRTLPFGDTIQGEQKKKSLVGTVTSDNHQDDEITTVEQNVDDSMQDETKFKP
RKKKKKPKAVSDDNEDTEGDNGVHEITSQDSPVYPKYLLDDDLVLGVYIHRTDRLKSDFK
ISRPMVKIHVVDEITGQYVKKDNSQRPVSSYFEKDNVDYILPIMTQPYDFKQLKSRLPEW
EEQIIFNENFPYLLRDFDESPKVILFFEILDFLSMDEIRNNSEIQNQECGFRKIAWAFLK
LLGANGNININSKLRLQLYYPPPKPRPHVKVVEVFEWWLKCPRNHYPSTLYVTVRGLKVP
ECVKPSYRSVVALQEEKGKPVYCEQQRESSSVDIEPGLEDSKEVVKWKRLPGQACRIPNK
HLFSLNAGERGCFCLSFSHNGRILAAACASRDGYPIILYEIPSGRFMRELYGHLNIIYDL
CWSKDDHYILTASSDGTARIWKNEINNTNTLKLLPHPCFVYTAKFHPAAKELVVTGCYDA
VVRIWKVDMKEDPAILIRHFDTHKSFINSLCFDIEGHHMYSGDCTGVIVVWNTYVKVNDL
QHSVRHWSVNKEIKESEFKGIPINYLEVHPNGKRLLIHTKDSTLRIMDLRILAARKFVGA
ANYREKIHSTLTPCGTFLFAGSEDGIVYVWNPETGEQVAMYSDLPFKSPIRDISYHPLEN
MVAFCAFGQNEPVLLYIYDFHVAQQEADTLNRYNGTSPFPGIHQSQDALCICSNMPQQGS
FQIDDYVHTKDSSMKMQQVIQRLNSVTTVVLNEASRKVNKNLSFTSTSASLQQSKLNESD
LLDTQPLRQFGFAQTGIINIERMPCNHHADTAPTVVALYDYTANRSDELTIHRGDIIRVF
YKDNEDWWYGSLGKGQEGYFPANHVASETLYRELPPEIKERSPPLTPKEKAKMEKPSLSS
QKVN
Download sequence
Identical sequences G1NX70
ENSMLUP00000001958 ENSMLUP00000001958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]