SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001994 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001994
Domain Number 1 Region: 153-269
Classification Level Classification E-value
Superfamily PX domain 3.4e-25
Family PX domain 0.0017
Further Details:      
 
Domain Number 2 Region: 36-136
Classification Level Classification E-value
Superfamily PDZ domain-like 8.28e-25
Family PDZ domain 0.0068
Further Details:      
 
Domain Number 3 Region: 273-340
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000186
Family Ubiquitin-related 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001994   Gene: ENSMLUG00000002189   Transcript: ENSMLUT00000002187
Sequence length 540
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429918:2271314:2319452:1 gene:ENSMLUG00000002189 transcript:ENSMLUT00000002187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEDGGRGFHPAAPHRNGGGGGGGGSGLHCAGNGGGSGPRVVRIVKSESGYGFNVRGQV
SEGGQLRSINGELYAPLQHVSAVLPGGAADRAGVRKGDRILEVNGVNVEGATHKQVVDLI
RAGEKELILTVLSVPPHEADNLDPSDDSLGQSFYDYTEKQAVPISVPTYKHVEQNGEKFV
VYNVYMAGRQLCSKRYREFAILHQNLKREFANFTFPRLPGKWPFSLSEQQLDARRRGLEE
YLEKVCSIRVIGESDIMQEFLSESDENYNGVSDVELRVALPDGTTVTVRVKKNSTTDQVY
QAIAAKVGMDSTTVNYFALFEVINHSFVRKLAPNEFPHKLYVQNYTSAVPGTCLTIRKWL
FTTEEEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSYQLQKLYEQRKMVMYLNMLRTC
EGYNEIIFPHCACDSRRKGHVITAISITHFKLHACTEEGQLENQVIAFEWDEMQRWDTDE
EGMAFCFEYARGEKKPRWVKIFTPYFNYMHECFERVFCELKWRKENIFQMARSQQRDVAT
Download sequence
Identical sequences G1NXA3
XP_006095344.1.53796 ENSMLUP00000001994 ENSMLUP00000001994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]