SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001996 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001996
Domain Number 1 Region: 499-548
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000086
Family UBA domain 0.0016
Further Details:      
 
Domain Number 2 Region: 11-82
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000292
Family Ubiquitin-related 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001996   Gene: ENSMLUG00000002182   Transcript: ENSMLUT00000002189
Sequence length 552
Comment pep:novel scaffold:Myoluc2.0:GL430451:329033:330860:-1 gene:ENSMLUG00000002182 transcript:ENSMLUT00000002189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGGGGSMAELSRAETRAPIRVTVKTPKDKEEIVISLRASVKEFEEEISRRFKAQQDQLVL
TSQGWDTLNQHGIEAGLSVHLVTPDPAAASASPPSAPEPASAPPPRCFTCHPCPAPHLWQ
CHFGSWHYGGILGLGGLGLGSTNFMKLQQQMQRQVMNPEMRSQIMENPLVQDMMSNPDLM
GHMIMANPQMQQLRERNPEISHMLNNPELMRQAMELEIQPAEMMRNQNQALSNLGSIPGG
YSALCRMYTDIQEPKFSAARKQFGNNTFSSLAGNSDSSSSQPLRSENREPLPNPWAPQAP
RSGGEGTGESATSQVHPTVSNPFGINAASLGSGMFNSPEVQALLQQISESPQLMQNMISA
PARSMMQTLAQNPDFAAQLMVNVQHFAGNPQLQEQLRLQLPGFLQQRQNPESPSLLQSPV
PCRRCCRRQQGIAEHCKLKPPDFPAAPGGGGGEAIKQQCRACTPGPHLLTSPTSHFSHRG
FQCSAAAHAADDPLLAESGNSQVQTPEVRFQPQLDQLNAMGFINSEANLQALIATGGDTN
AATERLLGSRLS
Download sequence
Identical sequences G1NXA5
ENSMLUP00000001996 ENSMLUP00000001996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]