SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001998 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001998
Domain Number 1 Region: 168-300
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-38
Family Third domain of FERM 0.00057
Further Details:      
 
Domain Number 2 Region: 66-170
Classification Level Classification E-value
Superfamily Second domain of FERM 3.53e-33
Family Second domain of FERM 0.00015
Further Details:      
 
Domain Number 3 Region: 2-63
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.55e-20
Family First domain of FERM 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001998   Gene: ENSMLUG00000002183   Transcript: ENSMLUT00000002191
Sequence length 805
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429810:2615343:2695836:1 gene:ENSMLUG00000002183 transcript:ENSMLUT00000002191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KHAKGQDLFDQIVYHLDLVETDYFGLQFLDSAQVAHWLDHSKPIKKQMKTGPAYALHFRV
KYYSSEPNNLREEFTRYLFVLQLRHDILSGKLKCPYETAVELAALCLQAELGECELPEHT
PELVSEFRFIPNQTEAMEFDIFQRWKECRGKSPAQAELSYLNKAKWLEMYGVDMHVVRGR
DGCEYSLGLTPTGILIFEGANKIGLFFWPKITKMDFKKSKLTLVVVEDDDQGREQEHTFV
FRLDSAKTCKHLWKCAVEHHAFFRLRTPGNSKSNRSDFIRLGSRFRFSGRTEYQATHGAR
LRRTSTFERKPSKRYPSRRHSTFKASNPVIAAQLCSKTNPEVHNYQPQYHPNIHPSQPRW
HPHSPNVSYPLPSPGLSSSDRLPFGIEENGGTPFTTKASGRHHHHHHHQHQHQHQHHPNY
GLSLTLENKEGPLRSPNSSSKSLTKLTPGAPALFNEAATHLKKLELDTVKAPGPWPTLHI
NINKVEEKKVSEKTLQTPLLPSPVADHVKCNILKAQLENASRVSAQAGKEESTFVNINKK
SSLQDANVRSPIPIRVETGQPAVEKPEIKPPRVRKLTRQYSFNRSDEDDLPPELAEAVGM
TTTATTSTTTAAAATQVSAPLASPKVHKVTSPQNSEAKSPLSPGAKSPSDRGGAFTLEPG
DLLMDFTEATPLAEPTSAPHCAHSRCSPPLSLPMKEETTGVCMHPPIKTRLIKTFPVDPV
TSFPEPFIAGPQFTADFRDSKLQCCPGQSSPLIPAVTLRPLTETISTVQTIYTTRKPVSL
AASAETLRQELEREKMMKRLLMTEL
Download sequence
Identical sequences G1NXA7
ENSMLUP00000001998 ENSMLUP00000001998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]