SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002011 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002011
Domain Number 1 Region: 500-759
Classification Level Classification E-value
Superfamily NHL repeat 1.96e-47
Family NHL repeat 0.00000736
Further Details:      
 
Domain Number 2 Region: 350-446
Classification Level Classification E-value
Superfamily E set domains 1.6e-22
Family Filamin repeat (rod domain) 0.0033
Further Details:      
 
Domain Number 3 Region: 126-188
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000275
Family B-box zinc-binding domain 0.0022
Further Details:      
 
Domain Number 4 Region: 35-109
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000042
Family RING finger domain, C3HC4 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002011   Gene: ENSMLUG00000002195   Transcript: ENSMLUT00000002206
Sequence length 761
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429768:21114212:21153477:1 gene:ENSMLUG00000002195 transcript:ENSMLUT00000002206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQCAGSKTAGPPCQWSRMASEATNIPSPVVRQIDKQFLICSICLERYKNPKVLPCLHTFC
ERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQNNFFITNLMDVLQRTPGSNVEESSI
LETVTAVAAGKPLSCPNHDGNVMDFYCQSCETAMCRECTEGEHAEHPTVPLKDVVEQHKA
SLQVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVLL
MELEVNYGLKHKVLQSQLDTLLEGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNE
LADQDFPLHPRENDQLDFIVETEGLKKSIHNLGTILTTNAVASETVATGEGLRQTIIGQP
MSVTITTKDKDGELCKTGNAYLTAELSTPDGSVADGEILDNKNGTYEFLYTVQKEGDFTL
SLRLYDQHIRGSPFKLKVIRSADVSPTTEGVKKRVKSPGSGHVKQKAVKRPASMYSTGKR
KENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTSGKILIADSNNQCVQIFSNDGQFKSRF
GIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSSDGKFKTKIGSGKLMGPKGVSV
DRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNEIIVTDFHN
HSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDGSGSFL
SYINTSADPLYGPQGLALTSDGHVVVADSGNHCFKVYRYLQ
Download sequence
Identical sequences G1NXC0
ENSMLUP00000002011 ENSMLUP00000002011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]