SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002012 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002012
Domain Number 1 Region: 630-899
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.31e-70
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000475
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-34
Family Third domain of FERM 0.00022
Further Details:      
 
Domain Number 3 Region: 112-217
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-32
Family Second domain of FERM 0.0002
Further Details:      
 
Domain Number 4 Region: 508-597
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-19
Family PDZ domain 0.00011
Further Details:      
 
Domain Number 5 Region: 27-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.13e-19
Family First domain of FERM 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002012   Gene: ENSMLUG00000002200   Transcript: ENSMLUT00000002207
Sequence length 910
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429810:2474112:2541539:1 gene:ENSMLUG00000002200 transcript:ENSMLUT00000002207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRLRAFGGRINNIRTSELPKEKTRSEVVCSIRFLDGLVQTFKVNKQDTGQVLLDMAYN
HLCVTEKEYFGLQHGDGSVDSPRWLESSKPIRKQLKGGFPCTLHFRVRFFIPDPNTLQQE
QTRHLYFLQLKMDICEGRLTCPLNSAVVLASYAVQSHFGDYNSSIHHPGYLSESQFIPDQ
NDDFVTKVESLHEQHSGLKQSEAESCFINIARTLDFYGVELHSGRDLHNLNLMIGIASAG
IAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQTESRDHIVAFNMLNYRSCKTLWKS
CVEHHTFFQAKKLLPREKNVLSQYWTLGSRNPNKSVNNQYCKKVIGGMVWNPAMRRSLSV
EHLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGSL
SPKDSDSEVSQNQSPHQESIPESNPAQSCPTRKSSSSVSPSSNAPGSCSPDGVDQQFLED
FHRVTKGGSTEDSSQYYCDKNDNGDGYLILIRITPDEEGKFGFNLKGGVDQKMPLVVSRI
NPESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHTRELALVIRRKAVH
SFADIKSEDELNQLFPEAIFPECPEGADTLEGSMEQLKKGLESGTVLIQFEQLYRKKPGL
AITFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASHVNMEIPAANLVNKYIAAQGP
LPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVAEHGSFHIRCQSEDCT
IAYVFREMLVTNTEVSGALTXLHLSKGGTWEELSWAMQKCWLSKFQVSAPLPPTPPPTPR
AGIGRTGVLVTMETAMCLIERNLPVYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILRVYE
EGLVPMLDPS
Download sequence
Identical sequences G1NXC1
ENSMLUP00000002012 ENSMLUP00000002012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]