SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002060 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002060
Domain Number 1 Region: 174-447
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.52e-85
Family Protein kinases, catalytic subunit 0.000000000127
Further Details:      
 
Domain Number 2 Region: 2-112
Classification Level Classification E-value
Superfamily PH domain-like 7.35e-25
Family Pleckstrin-homology domain (PH domain) 0.000000927
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002060   Gene: ENSMLUG00000002262   Transcript: ENSMLUT00000002263
Sequence length 467
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429952:2502947:2534544:-1 gene:ENSMLUG00000002262 transcript:ENSMLUT00000002263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGPGEDPM
EYKCGSPGDSSAAEEMEVAVSKARAKVSVREMNKPNVLGPKTFPEVVQACQQLLVTADEV
AHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARF
YGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATMKTFCGTP
EYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLS
PEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLPPPFKPQVTSEV
DTRYFDDEFTAQSITITPPDRYDSLGSLDMDQRTHFPQFSYSASIRE
Download sequence
Identical sequences G1NXG4
ENSMLUP00000002060 ENSMLUP00000002060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]