SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002087 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002087
Domain Number 1 Region: 6-162
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.75e-63
Family Cyclophilin (peptidylprolyl isomerase) 0.0000000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002087   Gene: ENSMLUG00000002299   Transcript: ENSMLUT00000002296
Sequence length 166
Comment pep:novel scaffold:Myoluc2.0:GL430720:96290:117455:1 gene:ENSMLUG00000002299 transcript:ENSMLUT00000002296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAIPPDSWQPPNVYLETSMGTIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDF
MVQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQ
WLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG
Download sequence
Identical sequences G1NXI7 L5M583 S7MMN8
ENSMLUP00000002087 ENSMLUP00000002087 XP_006107012.1.53796 XP_006759095.1.95426 XP_008150185.1.99482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]