SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002130 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002130
Domain Number 1 Region: 60-227
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000000297
Family BAR domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002130   Gene: ENSMLUG00000002349   Transcript: ENSMLUT00000002344
Sequence length 288
Comment pep:novel scaffold:Myoluc2.0:GL430499:105974:185523:-1 gene:ENSMLUG00000002349 transcript:ENSMLUT00000002344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNLTPAPAEDAQTRQLQNAVTNVEKHFGELCQIFAAYVRKTARLRDKADLLVNEVNVYAA
TETPNLKQGLKNFADEFAKLQDYRQAEVERLEAKVVEPLKAYGTIVKLKRDDLKATLTAR
NREAKQLTQLERTRQRNPSDRHIMNHAETELQRATMDATRTTRQLEETIDNFEKQKIKDI
KTIFSEFITIEMLFHGKALEVYTAAYQNIQKIDEEEDLEVFRNTLYPPDYSSRLDIVRAN
SKSPLQRSLSTKCVSGTGQVPTCRLRKDQQADDEEEEDEDLDVTEEEN
Download sequence
Identical sequences G1NXM5
ENSMLUP00000002130 ENSMLUP00000002130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]