SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002144 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002144
Domain Number 1 Region: 901-994
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-26
Family PDZ domain 0.00028
Further Details:      
 
Domain Number 2 Region: 729-829
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-24
Family PDZ domain 0.00013
Further Details:      
 
Domain Number 3 Region: 290-393
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-23
Family PDZ domain 0.0000496
Further Details:      
 
Domain Number 4 Region: 591-702
Classification Level Classification E-value
Superfamily PDZ domain-like 7.23e-22
Family PDZ domain 0.00045
Further Details:      
 
Domain Number 5 Region: 445-554
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-17
Family PDZ domain 0.0002
Further Details:      
 
Domain Number 6 Region: 18-89
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.06e-16
Family Nucleotide and nucleoside kinases 0.0038
Further Details:      
 
Domain Number 7 Region: 184-221
Classification Level Classification E-value
Superfamily WW domain 0.000000000000326
Family WW domain 0.0014
Further Details:      
 
Domain Number 8 Region: 232-266
Classification Level Classification E-value
Superfamily WW domain 0.0000000011
Family WW domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002144   Gene: ENSMLUG00000002347   Transcript: ENSMLUT00000002360
Sequence length 1309
Comment pep:novel scaffold:Myoluc2.0:GL429868:1117700:1172897:-1 gene:ENSMLUG00000002347 transcript:ENSMLUT00000002360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKVINKDLRHYLSLQFQKGSIDHKLQQVIRDNLYLRTIPCTTRAPRDGEVPGVDYNFISV
EQFKALEESGALLESGTYDGNFYGTPKPPAEPSPFQPDPVDQVLFDNEFDTESQRKRTTS
VSKMERMDSSLPEEEDDEDKEAINGTGHAESRERHSESSDWMKTVPSYNQTNSSMDFRNY
MMRDENLEPLPKNWEMAYTDTGMIYFIDHNTKTTTWLDPRLCKKAKAPEDCEDGELPYGW
EKIEDPQYGTYYVDHLNQKTQFENPVEEAKRKKQSGQADTGPSKPDTEKSHFTRDPSQLK
GILVQASLKKSTMGFGFTIIGGDRPDEFLQVKNVLKDGPAAQDGKIAPGDVIVDINGSCV
LGHTHADVVQMFQLVPVSQYVNLTLCRGYPLPDDNEDPAVDMVAATPVINGQSLTKGENT
QDFKSGAMALDQNGKPGQVLAGDRLNGPSDASEQRASMASSASSQPELVTVPLIKGPKGF
GFAIADSPTGQKVKMILDSQWCPGLQKGDVIKEIYHQNVQNLTHLQVVEVLKQFPVGADV
PLLILRGGPPSPTKTAKTKTDKKEHSGSLEAVNEPMPQPLPFPPSIVRSGSPKLDPSEVY
LKSKTLYEDKPPNTKDLDVFLRKQESGFGFRVLGGDGPDQAIYIGAIIPLGAAEKDGRLR
AADELMCIDGIPVKGKSHKQVLDLMTTAARNGHVLLTVRRKIFYGEKQPEDDSAQAFLST
QNGSPRLNRADAAARPAPPEAYEVVLQRKENEGFGFVILTSKTKPPPGVIPHKIGRVIEG
SPADRCGKLKVGDHISAVNGQSIVDLSHDSIVQLIKDAGVTVTLTVIAEEEHHGPPSGTN
SARQSPALQHRPLGQSQASHAPGDSSEGPWLLSRSETYRHSWADHKQLPQPDAAVISAVG
SRHHQGLGCYPVELERGPRGFGFSLRGGKEYNMGLFILRLAEDGPALKDGRIHVGDQIVE
INGEPTQGITHTRAIELIQAGGNKVLLLLRPGTGLIPDHGDWDTSHPPSPLVIYDEQSPS
APPSRSASMFEEPHVPVTGDSSARAQPRDQAELQDAAPGRKGTSHQSLQKNASKRDPPAG
HGHGDKKNLLKVENGVSRRGRSASPKKAASRYAEDHLETIPGPLKSDPKRRPRDRSSSPR
RGESKSGPSSARAGPGQDPARSSRGRSSSPKKQPRTEGSRDPPGAPASEGAQPASDGVRN
EAKQGPPGKTRARSPEKRSKRLDEKSLPSKKTPLVASRGGPESEKGKRAPVGEASEKKLK
PDPEDDSGKEAADSGRGSPGRRAPITPGPWKVPSASKASGSTGVAERRL
Download sequence
Identical sequences G1NXN9
ENSMLUP00000002144 ENSMLUP00000002144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]