SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002181 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002181
Domain Number 1 Region: 128-317
Classification Level Classification E-value
Superfamily PH domain-like 1.78e-63
Family Phosphotyrosine-binding domain (PTB) 0.00000000616
Further Details:      
 
Domain Number 2 Region: 472-577
Classification Level Classification E-value
Superfamily SH2 domain 1.02e-27
Family SH2 domain 0.00000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002181   Gene: ENSMLUG00000002396   Transcript: ENSMLUT00000002400
Sequence length 584
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429918:30574:36329:1 gene:ENSMLUG00000002396 transcript:ENSMLUT00000002400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLLPPKPKYNPLRNESLSSLEEGASGSSPPEELPSPSASSLGPILPPQAGDDSPTTLCS
FFPRMSNLKLANPAGARPGPKGEPGRVAEDGEGVAGAAVPDSGPLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGASRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
GGVVDMRLREGAPQGPARPTLPSAQNPSHLGATLPVGQPAGGDPEVHKQMPPLPPCPAGR
EIFDDPSYVNIQNLDKARQAGGGAGPPNLAVNGSAPRDLFDMKPFEDALRVPPPPQSVAM
AEQLRGEPWFHGKLNRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPE
GVVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL
Download sequence
Identical sequences G1NXS1
ENSMLUP00000002181 ENSMLUP00000002181 XP_006095143.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]