SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002204 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002204
Domain Number 1 Region: 65-166
Classification Level Classification E-value
Superfamily PDZ domain-like 3.94e-19
Family PDZ domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002204   Gene: ENSMLUG00000002426   Transcript: ENSMLUT00000002426
Sequence length 359
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429856:482928:508286:1 gene:ENSMLUG00000002426 transcript:ENSMLUT00000002426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLPRLMHQSSNGNLVDGCAGPACGSYSLLTGSFSMDDNRRIQMLADTVATLPRGRKQLA
LTRSSSLGDFAWSQRKLVTVEKQDNGTFGFEIQTYRLQNQNTCTTELCTLICKIQEDSPA
HCAGLQAGDILANINGVGTEGFTHKQVVDLIRSSGNLLTIETLNGTAILKKAELEAKLQV
LKQTLKKKWVEFRTLQLQEQRLLHGKYAANCPSLENMDIDESILFGTLPGAGSALPDRNR
LSSESSCKSWLSSMTMDSEDGYQTCVSEDSSKGAFSRQTSTDDECFVLKDGDDFLKKSSS
RNRSISTASSGSMSPMWESNFSSMFGTLPRKSRRGSVRKQLLKFIPGLHRPVEEEESRF
Download sequence
Identical sequences G1NXT9
ENSMLUP00000002204 ENSMLUP00000002204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]