SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002234 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002234
Domain Number 1 Region: 518-606
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-18
Family Third domain of FERM 0.0053
Further Details:      
 
Domain Number 2 Region: 332-425
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-17
Family Pleckstrin-homology domain (PH domain) 0.0058
Further Details:      
 
Domain Number 3 Region: 222-273
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000072
Family Second domain of FERM 0.011
Further Details:      
 
Domain Number 4 Region: 482-517
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000017
Family Second domain of FERM 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002234   Gene: ENSMLUG00000002453   Transcript: ENSMLUT00000002459
Sequence length 629
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429958:1840392:1878519:1 gene:ENSMLUG00000002453 transcript:ENSMLUT00000002459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDVKKDWSDHALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKV
KVNFSDRVFKAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLDDQSEDEALELEGPLI
TPGSGSIYSSPGLYSKTMTPTYDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPITSPE
ILAKMFKPQALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSFFDLNPKYDAIRI
NQLYEQAKWAILLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNSDKEVDEVDAALS
DLEITLEGGKTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKE
EASGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAAC
RLASKGKTMADSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDINPECLVSPRYLKKYK
NKQITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFMARFQGGKKEDLIGITYN
RLIRMDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIG
GYIFLSTRAKDQNESLDEEMFYKLTSGWV
Download sequence
Identical sequences G1NXW6
ENSMLUP00000002234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]