SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002246 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002246
Domain Number 1 Region: 6-101
Classification Level Classification E-value
Superfamily PH domain-like 4.55e-17
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.095
Further Details:      
 
Domain Number 2 Region: 173-630
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000000942
Family Armadillo repeat 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002246   Gene: ENSMLUG00000002470   Transcript: ENSMLUT00000002472
Sequence length 833
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430230:141090:176366:-1 gene:ENSMLUG00000002470 transcript:ENSMLUT00000002472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDTRRRVKVYTLNEDRQWDDRGTGHVSSGYVERLKGMSLLVRAESDGSLLLESKINPNT
AYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQDLVDESEEE
RFDDMSSPGLELPSCELSRLEEIAELVASSLPSPLRREKLALALENEGYIKKLLELFHVC
EDLENIEGLHHLYEIIKGIFLLNRTALFEVMFSEECIMDVIGCLEYDPALSQPRKHREFL
TKTAKFKEVIPISDPELKQKIHQTYRVQYIQDMVLPTPSVFEENMLSTLHSFIFFNKVEI
VGMLQEDEKFLTDLFAQLTDEATDEEKRQELVNFLKEFCAFSQTLQPQNRDAFFKTLSNM
GILPALEVILGMDDTQVRSAATDIFSYLVEYNPSMVREFVMQEAQQNDDVSKKLTEQKIT
NKDILLINLIIEHMICDTDPELGGAVQLMGLLRTLVDPENMLATSNKTEKTEFLGFFYKH
CMHVLTAPLLANTTEDKPSKDDFQTAQLLALVLELLTFCVEHHTYHIKNYIINKDILRRV
LVLMASKHAFLALCALRFKRKIIGLKDEFYNRYIMKSFLFEPVVKAFLNNGSRYNLMNSA
IIEMFEFIRVEDIKSLTAHVIENYWKALEDVDYVQTFKGLKLRFEQQRERQDNPKLDSMR
SILRNHRYRRDARTLEDEEEMWFNTDEDDMEDGEAVVSPSDKAKNDDDIMDPISKFMERK
KLKESEEKEVLLKTNLSGRQSPSFKLSLSSGTKTNLTSQSPATNLPGSPGSPGSPGSPGS
PGSVPKNTSQTAAITTKGGLVGLVDYPDDDEDDDEDEDKEDMLPLSKKAKFES
Download sequence
Identical sequences G1NXX7
ENSMLUP00000002246 XP_006103149.1.53796 XP_008146645.1.99482 ENSMLUP00000002246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]