SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002310 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002310
Domain Number 1 Region: 37-148
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-23
Family PDZ domain 0.0043
Further Details:      
 
Domain Number 2 Region: 179-254
Classification Level Classification E-value
Superfamily PDZ domain-like 9.46e-21
Family PDZ domain 0.00011
Further Details:      
 
Domain Number 3 Region: 704-804
Classification Level Classification E-value
Superfamily PDZ domain-like 8.54e-19
Family PDZ domain 0.0000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002310   Gene: ENSMLUG00000002529   Transcript: ENSMLUT00000002540
Sequence length 871
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429891:1843081:1876933:1 gene:ENSMLUG00000002529 transcript:ENSMLUT00000002540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTMDVAVLVGDLKLVINEPSRLPLFDAIRPLIPLKHQVEYDQLTPRRSRKLKEVRLDRLH
PEGLGLSVRGGLEFGCGLFISHLIKGGQADSVGLQVGDEIVRINGYSISSCTHEEVINLI
RTKKTVSIKVRHIGLIPVKSSPDEPLKWQYVDQFVSGSEGGRNILGSLGNRENREKKVFI
SLVGSRGLGCSISSGPTQKPGIFISNVKPGSLSAEVGLEAGDQIVEVNGIDFSNLDHKEA
VNVLKSSRSLTISIVAGAEGRELFMTDRERLEEVRQRELQRQELLMQKRLAMESNKILQE
QREMEQQRKKEIAQKAAEENERYRKEMEQIVEEEEKFQKQWEEDWGSREQLLSSKTISAE
MHPVPLRKPKSFGWFYRYDGKFPSIRKKGKDKKAKYDSLQELRKNKKELEFEQKLYKEKE
EMLEKEKQLKINRLAQEVSETEREDLEESEKIQYWVERLCQTRLEQISSADNEISEMTTG
PPPSMSPLAPPLRRFAGGLHLHTTDLDDISLDMFYYPPKIPSALPVMPHPPPSNPPSKVP
ATPVLPSSGRVSASSSPWVQHTPPPIPIPPPPSIPTQDLTPTRPLPSALEEALGNHTFRA
GDTGNPTEDWEAKNHSGKPANSPIPERSFPPTPKTFCPSPQPPRGPGVSTISKPVMVHQE
SNFIYRPAVKSEVLPQEMLKRMVVYQTAFRQDFRKYEEGFDPYSMFTPEQIIGKDIRLLR
IKKEGSLDLALEGGVDSPIGKVVVSAVYEGGAAERHGGLVKGDEVMAINGKIVTDYTLAE
AEAALQKAWNQGDWIDLVVAVCPPKEYDDELSSLPSSAAESPQPVRKLLEDRAPVVRHGF
FLQLEPGDLLLKSGRRNQIHPLKPVSSGPAL
Download sequence
Identical sequences G1NY37
ENSMLUP00000002310 ENSMLUP00000002310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]